(data stored in ACNUC7421 zone)

EMBL: CP000088.PE466

CP000088.PE466       Location/Qualifiers
FT   CDS_pept        complement(529261..530481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0468"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54506"
FT                   /db_xref="GOA:Q47SR1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54506.1"
FT                   /translation="MGMESSPESPQPVRVVLQAVGGWIGRLGRIWIEGQVAELHRRGGM
FT                   AYITLRDPVANVSARVTCSIRVLRAADPPPEQGARVVVYAKPDFYVPRGTFSFQALEIR
FT                   HVGLGELLARLERLRQALAAEGLFAESRKRKLPFLPGVVGLICGRDSAAERDVLENARR
FT                   RWPAVRFEVREVAVQGDRAVPEVMAALEELDAHPEVDVIIIARGGGSLEDLLPFSDEAL
FT                   VRAVAAARTPVVSAIGHEQDTPLLDYVADLRASTPTDAAKKVVPDVGEQWELIRQLRDR
FT                   ARRVLEGGIAREEAWLASMRSRPVLANPVQEVERKIEQVFDLRDRGRRALTAALDRAGD
FT                   NLAHIRARLHALSPATTLARGYAIVRRADGTVVRSAAEVAPGEELRLRFAEDGLVAIAQ
FT                   NREEDEL"
     atgggcatgg agagttcccc cgagtccccg cagccggtac gtgtggtctt gcaagccgtg        60
     ggcggctgga ttggacggct cggccggatc tggatcgagg ggcaggtcgc ggagctgcac       120
     cgccgcggcg gcatggctta catcacgctg cgtgacccgg tggcgaacgt gtccgcccgg       180
     gtgacctgtt cgatccgggt gctgcgggcc gctgacccac cccccgagca gggagcccgg       240
     gtggtggtgt acgccaaacc cgacttctat gtgccgcgcg gcacgttctc gttccaagcg       300
     ttggagatcc gccatgtcgg cctgggcgag ctgctcgccc ggttggagcg gctgcggcaa       360
     gccctggccg ccgaggggtt gttcgcggag tcccggaagc ggaaactgcc gttcctgccc       420
     ggggtggtgg ggctgatctg cggacgcgac tccgccgcgg aacgggacgt gctggagaat       480
     gcgcggcggc ggtggcccgc cgtccggttc gaagtgcgcg aagtcgcagt ccaaggcgat       540
     cgtgccgtgc ccgaggtcat ggccgcgctg gaggaactgg acgcgcaccc cgaggttgat       600
     gtcatcatca tcgcgcgggg cggcggctcc ctggaagacc tgctgccgtt ctccgacgag       660
     gccctggtgc gtgcggtcgc ggctgcccgc acccccgtgg tcagcgcgat cgggcacgaa       720
     caggacacgc cgctgctgga ctatgtggcg gacctgcggg cctccacgcc cacggatgcc       780
     gccaagaaag tcgtccctga cgtgggagag cagtgggagc tcatccgcca gctgcgggac       840
     cgggcgcgcc gggtgctgga aggcggaatc gcgcgggaag aagcgtggct ggcgagcatg       900
     cggtcccgcc ctgtcctggc caacccggtc caggaagtgg aacggaagat cgagcaggta       960
     ttcgacttgc gggaccgggg acgccgggcg ctcaccgctg ccctcgaccg ggccggagac      1020
     aacctcgctc acatccgtgc ccggttgcat gccctgtccc ccgccaccac gctggcacgg      1080
     gggtacgcga tcgtgcggcg tgccgacggc acggtggtgc gttccgccgc tgaggtggcc      1140
     cccggggagg agctgcggtt gcggttcgcc gaggacgggc tggtcgcgat cgctcaaaac      1200
     cgagaggagg acgagctgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page