(data stored in ACNUC7421 zone)

EMBL: CP000088.PE471

CP000088.PE471       Location/Qualifiers
FT   CDS_pept        534199..535293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0473"
FT                   /product="Conserved hypothetical protein 92"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54511"
FT                   /db_xref="GOA:Q47SQ6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54511.1"
FT                   /translation="MSLSIGIVGLPNVGKSTLFNALTKNDALAANYPFATIEPNIGVVG
FT                   VPDPRLDTLAEIFGSARTVPATVTFVDIAGIVRGASEGEGLGNQFLAHIRETDAICQVI
FT                   RVFEDPDVTHVDGVVDAARDIETINTELILADLQTLDKALTRLAREARANAKDKEKQET
FT                   LAAAEKARTVLDSGKTLFSGAAEAGVDVGLLRELNLLTTKPFLYVFNGNLEAFADEAFR
FT                   AKLSGLVAPAEAIFLDAKLEAELSELDEDEAAELLESMGQTESGLAQLARVGFDTLGLQ
FT                   TFLTAGPKEARAWTIRKGATAPEAAGVIHSDFQRGFIKAEVVSFDDLVAAGSLQEARAA
FT                   GKVRMEGKDYVMADGDVVEFRFNV"
     gtgagtctgt ctatcgggat cgtcggcctg ccgaacgtcg gcaagtccac actgttcaac        60
     gcgctgacca agaacgacgc cttggcggcg aactatcctt tcgccacgat cgaacccaac       120
     atcggagtgg tcggtgtccc cgacccgcgg ctggacactc tcgccgagat cttcggctcg       180
     gccaggactg ttccggccac ggtcactttt gtggacatcg cggggattgt ccgaggggct       240
     tccgaagggg aagggctagg caaccagttc ctcgcccaca ttcgggagac cgacgcgatc       300
     tgccaggtca tccgggtgtt tgaggacccc gacgtgaccc acgtcgacgg ggttgtggac       360
     gccgcgcgcg acatcgagac catcaacacc gagctcatcc tggccgacct gcaaaccttg       420
     gacaaagcgc tgacccggct ggcccgggaa gccagagcca acgccaagga caaggagaag       480
     caggagacgc ttgccgcagc ggagaaggcg cgcacagtcc tcgactccgg aaaaaccctg       540
     ttctcggggg ccgctgaggc cggcgtggac gtcggactgc tgcgcgaact gaacctgctc       600
     accaccaagc cgttcctcta cgtgttcaac ggcaacctgg aagcgttcgc cgacgaggcg       660
     ttccgcgcca aactgtccgg actcgtggcc ccggccgaag cgatcttctt ggacgccaag       720
     ctcgaagcgg agctgagcga gctcgacgag gacgaggcag ccgaactctt ggagtcgatg       780
     gggcagaccg agtccggcct ggcacaactg gcccgggtcg gtttcgacac tctcgggttg       840
     cagacgttcc tcaccgcggg gccgaaggag gcgcgcgcct ggacgatccg gaagggcgct       900
     actgcccccg aggcggccgg ggtgatccac agcgacttcc agcgcggttt catcaaagcc       960
     gaagtggtct ccttcgacga ccttgtggca gcgggctcgc tgcaggaagc ccgggccgcg      1020
     ggcaaggtcc gcatggaagg caaggactac gtgatggctg acggggacgt ggtggagttc      1080
     cggttcaacg tctaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page