(data stored in ACNUC7421 zone)

EMBL: CP000088.PE473

CP000088.PE473       Location/Qualifiers
FT   CDS_pept        536968..537279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54513"
FT                   /db_xref="GOA:Q47SQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54513.1"
FT                   /translation="MLSLLTGFAADLAAAASTTLHLAAEVTDSPNTTGLADWLRGFFGP
FT                   LFLVIVSIVAIFFLFTREITRFAQFIILAIFIGIVFYVPGIIEVLAVAIARAMGVSTE"
     atgctctccc tcctcaccgg ctttgcagcc gacctggccg ccgcggcatc cacaacgttg        60
     catctggccg ccgaggttac ggacagcccc aacaccacag ggctagcgga ctggctccgc       120
     ggatttttcg ggcccctgtt cctggtgatc gtgtcgatcg tcgcgatctt tttcctgttc       180
     accagggaaa tcacgcgatt cgcgcagttc atcatcctgg cgatctttat tgggatcgtc       240
     ttctatgtgc ccgggatcat cgaggtcctc gccgttgcta tcgcgcgagc catgggcgtg       300
     agcaccgagt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page