(data stored in ACNUC7421 zone)

EMBL: CP000088.PE476

CP000088.PE476       Location/Qualifiers
FT   CDS_pept        543992..545614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54516"
FT                   /db_xref="GOA:Q47SQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54516.1"
FT                   /translation="MEKAEWESANDFAVRQNSQMLWSGLVCRPWIAGEFGTGPVANVAA
FT                   RYHAMDLLEAQGVSRLEQYQIANGEIDAAELYSEKQASYEEISANIKNAYPEVYPIFEG
FT                   SQQGIRLGVASLALFASIFAGGVILVGSVALIVLKIGFLLLLLLAPIFLLIGVHPGYGR
FT                   TVLVRWFELLLGLLLKQIFVVLLIALLVMCYGLVMATDLGWGLQMILLALFTVALFIYR
FT                   KPFANLFASVNANTFTSRMVNDALNSRVLAASANVLPPVAYMKAQKWGLDRAPQLAAGA
FT                   AALPAGAAATAGAAAGADAAEAEGVATATEGDNEGATATESGGRARARGVAGYGRTPGK
FT                   AAPPPLNLDGSSKSGGASRAGVAPQRDSSQAPRLSTASSASSSLFEGTGGGGAIPPRPA
FT                   GGYTGVGDTGWSSVFGTGSSGNAHRAEAAPRASKDAAPPRADSSASGTGLFGGRTETPP
FT                   QGSTLPRPSRWAGPGTRGEKRTPPPARPAPAPSSSEQSSGEGGTWLSGSRKDKDAPISP
FT                   FWAEGAGRRDRTREVPFWLDSDD"
     atggagaaag cggaatggga gagtgcaaac gattttgctg tccgacagaa ttctcaaatg        60
     ctttggtccg gccttgtttg taggccgtgg attgctggcg agtttggtac ggggccagtg       120
     gcgaacgttg cggcaagata tcacgctatg gatctcctgg aagctcaggg agttagccgc       180
     ctggaacagt accaaatagc taatggagaa atagacgctg cagagctgta ttctgaaaag       240
     caagcttcct acgaagagat atccgccaat attaagaatg catatccaga agtttatcca       300
     atcttcgaag ggagtcagca aggaattcgt cttggagtag cctccctcgc gctattcgct       360
     tccatctttg ctggcggagt cattcttgta ggctctgtag ccttgatcgt cctcaagata       420
     ggttttcttc tcctcctgct gcttgctcct atattcctcc tcattggcgt tcaccctggg       480
     tatgggcgta cagttctagt ccgctggttt gaacttctgc tcggcttgtt gctcaagcag       540
     atattcgtcg tccttctcat cgcgcttctg gtcatgtgct acggcctggt gatggccact       600
     gaccttggct ggggccttca gatgattctg ctggctctgt tcaccgtggc gctgttcatc       660
     taccgcaagc ctttcgcgaa cctcttcgct tcggtgaacg ccaatacctt cacctcgcgc       720
     atggtcaacg atgcgctcaa cagccgggtg ctggccgcca gcgcgaatgt cctgccgccc       780
     gtggcctaca tgaaagcgca gaagtggggc cttgatcggg caccacagct tgcggctggg       840
     gccgctgctc ttccggctgg tgcggcagcg acagcaggag cggcagccgg tgccgatgca       900
     gcagaagccg agggcgttgc caccgcgacg gaaggcgaca acgagggcgc gaccgctacc       960
     gagagcggcg gtcgcgcgcg ggcccgggga gtggcgggtt acggccggac cccgggtaaa      1020
     gcggctccgc ctccgctgaa cctcgacggc agttccaaat ccggcggtgc ctcaagggct      1080
     ggcgtcgcac cgcaacggga ctcctcccaa gcaccccgac tcagcacggc atcatccgcc      1140
     agcagcagtc ttttcgaagg aaccggcggt ggcggggcca ttccgccgcg cccggccggc      1200
     ggctacaccg gggtcggaga caccggatgg agctcagtgt tcgggacagg ttcctccggt      1260
     aacgcgcatc gcgccgaagc ggcaccgcgt gccagtaaag acgccgcgcc tccacgagcg      1320
     gactcctctg cctcagggac cggcttgttc ggaggccgca cggagacccc gccccagggc      1380
     agcacactgc ctcgcccctc ccggtgggct gggcctggca cccggggtga aaaacggact      1440
     ccgccgcctg cccgacccgc gccagcaccg agctccagtg agcagagcag cggcgaaggc      1500
     ggtacctggc tgagcgggtc ccgcaaggac aaggacgctc cgatcagccc gttctgggcc      1560
     gagggtgctg ggcgtcgcga ccgtacgcgg gaggtgccct tctggttgga cagcgatgac      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page