(data stored in ACNUC7421 zone)

EMBL: CP000088.PE477

CP000088.PE477       Location/Qualifiers
FT   CDS_pept        545701..546351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54517"
FT                   /db_xref="GOA:Q47SQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54517.1"
FT                   /translation="MSKPLSDGAQRLVFGVLIVALVSFGIYWSLGGGSDTSDPEQQEQV
FT                   AEGGRTETLEEGGEDQPVEPLPTVAAEDMALADWLPFSEEEFIAAAAVAQEFATDYGTI
FT                   DYSKSPQEYYDRLGEHATKEYARTLAQSSGAEALWGERAEQKATSTGRAVVKSIRGFDD
FT                   ESIVFILKVQSITESDDGKAQNLGDFAVTMVKEGGSWRVYDFQPADAGNLGGG"
     atgtccaagc cactttccga cggcgcacag cgccttgtct tcggtgtcct gatcgtggcc        60
     ctcgtctcct tcggcatcta ttggagcctg ggaggtggtt ctgacacgtc agacccggag       120
     cagcaggagc aggtggccga aggcggcagg actgagaccc tggaggaagg gggagaggac       180
     cagcctgtcg agccgctgcc caccgtggcg gctgaagata tggcgctcgc cgactggctg       240
     cccttcagcg aagaagagtt cattgctgca gcggctgtgg cccaggagtt cgccaccgac       300
     tacggcacca tcgactattc gaaatccccc caggagtatt acgacaggct cggcgagcac       360
     gccaccaagg agtatgcccg gactctcgcg cagagctctg gtgctgaagc gctgtgggga       420
     gaacgcgctg aacagaaggc gacctccact gggcgggcgg tcgtcaagtc gatccgcggc       480
     ttcgacgatg agtcgatcgt cttcatcctc aaagtgcagt ccattacgga aagcgatgac       540
     ggtaaagccc agaatctcgg agacttcgcc gtcaccatgg tcaaagaagg cgggagctgg       600
     cgggtctacg acttccaacc ggctgatgca ggcaacctgg gaggcgggtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page