(data stored in ACNUC7421 zone)

EMBL: CP000088.PE48

CP000088.PE48        Location/Qualifiers
FT   CDS_pept        complement(53663..55018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0050"
FT                   /product="conserved hypothetical protein with similarity to
FT                   AbiLI: abortive phage resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54088"
FT                   /db_xref="GOA:Q47TX6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54088.1"
FT                   /translation="MLLRFRVANHRSIREEQELSLVAVPKRGEAKPKAHEIPPTVHVAG
FT                   IYGANASGKSNVLDALRWMSAAVKYSHIHWQPDAGVPRKPFRLDDTSHEEPSFYEIDFV
FT                   FEGVRHSYGFEVTDREVVGEWLFVFPHGRPKRLFEREGPQDYKFGKSLKGELRRIEKLT
FT                   RPNSLYLSCAASNNHPYLSSIHHWIGTHIRFATQNSFDEGVRFRFTQSLIEDPGSKGAE
FT                   YVSRLVRVADLGITDIVLSKREIDGFEKEFISFIRERLPDIPEEEFRKRIEQRPLFIHD
FT                   YSGKPRPLPIDEESDGTRSWFGLVGFVLRVLEEGDVFLVDEIDSSLHPVLSSTLIRMFK
FT                   DPVINPKGAQMVFASHDTTLLGTMLENKLLERDEVWFTEKDAHGATSLYSLVEFHPRGD
FT                   ENPERGYLQGRYGAVPHVNFQEIRSLFAELHGAAGEPSASAETGPPPESQYA"
     atgttgctgc gtttcagagt ggccaaccac cggtcgatcc gcgaggagca ggaactgtct        60
     ctcgtcgcgg tccccaaacg gggggaggcg aagccgaagg ctcacgagat cccgcccacg       120
     gtccacgttg cagggatcta cggggccaac gcctcgggaa aatctaatgt gctggatgcc       180
     ttgcggtgga tgagcgcagc ggtcaagtac tcgcacatcc actggcagcc tgatgccggg       240
     gtgccaagga agccgttccg gttggacgac acctctcacg aagagccttc gttctacgag       300
     atcgacttcg tttttgaggg tgtacggcac tcctatgggt tcgaagtcac cgaccgcgaa       360
     gtcgtgggag agtggctttt cgtgttcccg cacgggcgcc ccaagcggct tttcgagcgg       420
     gaaggaccac aggactacaa gttcggcaaa tccctcaaag gggaattgcg ccgtattgag       480
     aaacttaccc gccctaattc cctctacctg tcgtgcgcgg cgtcgaacaa ccacccctat       540
     ctttcttcca tccaccactg gatcgggact cacatccgtt tcgctacgca gaattccttc       600
     gatgaaggcg tcaggttccg cttcacccag tctctgatcg aggaccccgg gagcaaaggg       660
     gcagagtacg tcagccggct cgtacgagtc gctgacctgg gcatcacaga catcgtcctt       720
     tccaaaagag aaatcgacgg cttcgagaaa gaattcatct ctttcatcag ggagagactc       780
     cccgatatcc ctgaagaaga attccgcaag cgaatagagc agcgcccgct gttcatccac       840
     gattactcgg gaaaacctcg accgcttcct atcgacgagg agagcgatgg gacgcgttcg       900
     tggtttggtc tcgtgggatt tgtgctgcgc gtgcttgagg aaggggacgt cttcctcgtc       960
     gacgagatcg actccagcct gcacccggtc ctctcgtcca ctctcatccg gatgttcaaa      1020
     gatccggtca tcaaccccaa gggtgcacaa atggtgtttg cctcacatga caccactctt      1080
     ctcggtacca tgctggaaaa caaacttctc gaacgggacg aagtatggtt caccgagaag      1140
     gatgcccacg gggcgacctc cctctactcc ctcgtcgaat tccatccgcg gggcgacgag      1200
     aatccggaac ggggctacct tcaaggcaga tacggcgctg tgccccacgt gaatttccaa      1260
     gagatccggt cgctcttcgc cgaacttcac ggggccgccg gtgaaccgtc cgcgtcggct      1320
     gaaacgggac ctccgccgga aagtcaatac gcgtaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page