(data stored in ACNUC7421 zone)

EMBL: CP000088.PE484

CP000088.PE484       Location/Qualifiers
FT   CDS_pept        554504..555364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54524"
FT                   /db_xref="GOA:Q47SP3"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017810"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54524.1"
FT                   /translation="MNDRRLLLVHAHPDDETIVTGATMARYAAEGAHITLVTCTLGEEG
FT                   EVIPPELAHLASDREGGLGEYRVTELERACAALGVHDQRFLGGKGRYRDSGMMGAPTNS
FT                   HPACFWQADVDTAAHELAAIIREVRPQVIVTYDDNGGYGHPDHIQAHRVTMRAFAQAAD
FT                   PSLPGTPWQARKLYAIAQPRKLLEESVARMQADPGPFTAPTAVEDIAPGTPDDLVTTRI
FT                   DGSAYWEKKRDALQAHATQVAVAGTRFALSNGIAQEIHAVEYFTLLHGPEPRRGPDGYE
FT                   TDLFA"
     atgaacgacc gtcgcctgct gctggtgcac gcccatcctg acgacgaaac catcgtcacc        60
     ggggcgacca tggcccgata cgcggccgag ggagcccaca tcacgcttgt gacctgcacc       120
     ctcggtgaag aaggggaagt gatccccccg gaactggccc atttggcgag tgaccgggaa       180
     ggcggactag gcgagtaccg tgtgacggaa ctcgaacgcg cctgcgccgc attgggtgtc       240
     cacgaccagc ggtttctggg cggcaagggg cgctaccgcg actcaggcat gatgggtgcc       300
     cccacgaaca gccaccccgc gtgcttctgg caggccgacg tggacacggc cgcccacgaa       360
     ctcgccgcga tcatccggga agtgcgcccc caagtcatcg tcacctacga cgacaacggc       420
     ggctacgggc accccgacca catccaagcg caccgggtga ccatgcgcgc cttcgctcaa       480
     gccgcggacc cctccctgcc gggcaccccc tggcaagccc gcaagctgta tgcgatcgcc       540
     cagcccagga agctgctgga agagtcagtg gcacgcatgc aagccgaccc gggcccgttc       600
     accgcgccca ccgcggtgga ggacatcgcc cccggcaccc cggacgacct ggtgaccacc       660
     cgcatcgacg gctccgccta ctgggagaag aagcgggacg ctctgcaggc gcacgccacc       720
     caggtcgctg tggcgggcac ccggttcgcg ctctccaacg gcatcgccca ggagatccac       780
     gccgtggagt acttcaccct gctgcacggc ccggaacccc gccgcggccc cgatggctac       840
     gaaaccgacc tgttcgcctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page