(data stored in ACNUC7421 zone)

EMBL: CP000088.PE487

CP000088.PE487       Location/Qualifiers
FT   CDS_pept        complement(556860..558194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54527"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54527.1"
FT                   /translation="MQETVAAALAHLTRTDPVAAHVAQSALDTLLSGRRLETLTQHAVQ
FT                   EFCWHVLPVRFSSEPSEWQFVTDSLSSLFRLLDLDRYADICVSERTREVLRAYATSHDQ
FT                   GLAAYERSMRSSGVIPPDLPELTWGTALGNAEIEAYRETSAVLELAIAAGEVRPGTRGW
FT                   RAAQEERARSFLTQPDHHGLSYLDKIRQERVAEWLASRSHPHREHLLPLRGQLTAGVDM
FT                   PRNAADALAPVQRLLDYAADGIALTQIGYISPAVVRALCDEFGWWTSPSPPRSETDVMQ
FT                   LIVLHKLLRAMRAVRRSGRRLVLTRHGRQLHSDLNELWRAVAESVLATDGFEQAAIETL
FT                   LGVLLLRSPQSASAPYGDADIDVADEACRLLIQSGWEDDVIGGRPRTDQVRSVLISVVW
FT                   LLEILGCITGPDLLGDGPTPQLTKVGRAFALTALHLSATAPAASL"
     gtgcaggaaa ccgtggccgc tgccctcgct cacctgacgc gcacggatcc ggtcgccgcc        60
     cacgtagcgc agagcgcctt ggacactctg ctctccggcc ggcgattgga aaccctgacc       120
     cagcacgccg tccaagagtt ctgctggcac gtcctcccgg tgcggttctc ctccgagccc       180
     agcgagtggc agttcgtcac cgactcgctc agctccctct tccgcctcct cgatttagac       240
     cgctacgccg acatctgcgt atcggaacgc acccgcgaag tgctgcgcgc ctatgcgacc       300
     tcccacgacc agggcctggc agcctacgag cgcagcatgc gctcctccgg ggtgatcccg       360
     cccgacctgc ccgaattgac gtgggggacc gcgctcggca acgccgagat cgaagcctac       420
     cgggagacgt ccgcggtact ggagctggcg atcgccgcag gtgaagtacg tccaggcacg       480
     cgcggctggc gggcagccca agaggagcgc gcccgcagct tcctcaccca gcccgaccac       540
     cacggcctca gctatctgga caagatccgc caggaacggg tcgcggagtg gctggcgtcc       600
     cgctcccacc cgcaccggga gcacctgctg cccctgcgcg gccagctcac cgccggcgtg       660
     gacatgccgc gcaacgcggc tgacgcgctc gcccccgtgc agcggctgct cgactatgcc       720
     gccgacggga tcgcgctcac ccagatcggc tacatatctc ctgccgtggt gcgggcgctg       780
     tgcgacgaat tcggctggtg gacatcgccg tcgccgccgc gcagcgaaac cgatgtcatg       840
     cagctcatcg tgctgcacaa actgctgcgg gctatgcggg cggtgcgacg ctccggccgt       900
     cggctggtgc tgacccggca cgggcggcag ctccacagcg acctcaacga actgtggcgc       960
     gcggtcgcgg aaagtgtgct ggccaccgac ggtttcgagc aggccgcgat cgaaaccctg      1020
     ctgggtgtgc tgctgctccg ctccccgcag tcagcgtccg ccccatacgg tgacgccgac      1080
     atcgacgtcg ccgacgaggc gtgccggctg ctcatccagt ccggctggga ggatgacgtc      1140
     atcggcgggc ggccccgcac cgaccaggtg cgctccgtcc tcatcagcgt ggtgtggctg      1200
     ctggagatcc tggggtgcat caccggcccc gacctgctcg gcgacggccc caccccccag      1260
     ttgacgaagg tggggcgggc ttttgcgctc accgcgctcc acttgtcggc gacggccccg      1320
     gccgcgtcac tgtag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page