(data stored in ACNUC7421 zone)

EMBL: CP000088.PE488

CP000088.PE488       Location/Qualifiers
FT   CDS_pept        complement(558248..558499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54528"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54528.1"
FT                   /translation="MGYVARFTHAITKDDVGQRVTVRFRLPDGRFRDIVGVLESWHDDV
FT                   LVLRRRDGSLAHVTAAEIVASKVVPPQPPRRSGAPGSA"
     gtgggatacg ttgcccgctt cacccacgcc ataaccaaag acgatgtcgg ccagcgagtc        60
     actgtgcgtt tccggctgcc agacgggaga ttccgggata tcgtcggtgt attggagtca       120
     tggcacgacg atgtgctcgt gttgcgccgc cgcgacgggt cgctcgcgca cgtgaccgcc       180
     gcggagatcg tggccagcaa ggtcgtgccg ccgcagccgc cccggcgttc cggcgcaccg       240
     ggttccgcgt aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page