(data stored in ACNUC7421 zone)

EMBL: CP000088.PE494

CP000088.PE494       Location/Qualifiers
FT   CDS_pept        563593..564402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0496"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54534"
FT                   /db_xref="GOA:Q47SN3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54534.1"
FT                   /translation="MTDSRSIERQAGPLTYRGREIPKSTTDQRLLDRRGPTDWVHTDPW
FT                   RVLRIQSEFVEGFGMLSEVGRAVCVFGSARIKPETPYYELGEEIGRKLVEAGYTVITGG
FT                   GPGLMEAANKGAADVGGTSIGLGIELPFEQSLNDYVNLGVVFRYFFVRKTMFVKYSQAF
FT                   VVLPGGFGTLDELFEALTLVQTGKITRFPVILVGTDFWGGLVEWINDRLLAEGLISPSD
FT                   PDLIHLTDDPDDVIETIQRAHAEWERALEEEEAVTELEEALREAEHS"
     atgacggatt ctcgatcgat cgaacggcag gcaggtcccc tcacctaccg gggaagagag        60
     atccctaaga gcaccactga ccagcggctg ctggaccgtc gcggcccgac ggactgggtg       120
     cacaccgatc cctggcgggt gctgcgcatc cagtcggagt tcgttgaggg cttcggcatg       180
     ctctccgagg tgggcagggc cgtgtgcgtg ttcggctcgg cccggatcaa accggagacc       240
     ccctactacg agctggggga ggagatcggc cgcaagctcg tggaggccgg gtacacggtc       300
     atcaccggcg gcggtccggg gttgatggag gccgccaaca agggggccgc cgacgtcggc       360
     gggacctcga tcggcctcgg tatcgagctg ccgttcgagc agtcgctcaa cgactacgtc       420
     aacctggggg tcgtcttccg gtacttcttc gtccgcaaga cgatgttcgt gaagtactcc       480
     caggcgttcg tcgtgctgcc gggcggcttc ggcacgctcg acgagctgtt cgaagcgctc       540
     accctggtgc agaccggcaa gatcacccgc ttcccggtga tcctggtggg cacggacttc       600
     tggggcggcc tggtggagtg gatcaacgac cggctgctcg ctgaaggctt gatctctccg       660
     agcgaccccg atctgatcca cctcaccgac gacccggacg acgtcatcga gacgatccaa       720
     cgggcccacg cagagtggga gcgggccctg gaagaggagg aggcggtcac agagctggag       780
     gaggccctgc gggaagccga gcactcctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page