(data stored in ACNUC7421 zone)

EMBL: CP000088.PE498

CP000088.PE498       Location/Qualifiers
FT   CDS_pept        566517..567989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0500"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54538"
FT                   /db_xref="GOA:Q47SM9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54538.1"
FT                   /translation="MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQG
FT                   GQGVVYLGSAPDGARVAVKTLHRDALDLPGLREQLAEEVEMARRVARFCTAQVLAADLD
FT                   ADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPAN
FT                   VLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATL
FT                   VYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETLM
FT                   LVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHS
FT                   NVAAQPSPTPPPHPQTASGPQPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPP
FT                   PGPHQHAYPTPHSGNAAIPPHGGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEG
FT                   TSTAFVLGVVSIAVIAGVLLFILLFLLIGSLG"
     atgcccgccg ccagccagga caacgacggc gggcccagcc aatcgggagg accgatggcc        60
     gatccggccc ccttgatcga caccgacccc gcgcgcatcg gggagtacac gctacttgga       120
     cggctcggac agggcggtca gggagtcgtc tacctcggaa gcgcccctga cggggcacgg       180
     gtggcggtca agacgctgca ccgggacgcc ctcgacctgc cgggcctgcg cgaacagctc       240
     gccgaagaag tcgagatggc ccgccgggtt gcgcggttct gcaccgcgca agtgctcgcc       300
     gccgacctcg acgccgaccc gccctacgtg gtcagcgagt acgtggaagg cccctcgctg       360
     caggccgtgg tccgcgagcg agggccgctg cgcggagcca gcctggaacg gctcgcagtc       420
     ggcaccctca ccgccctcgc cgccatccac caggccggaa tcgtgcaccg cgacttcaaa       480
     ccggccaacg tgctcatggc ccccgggggc ccgcgcgtca tcgacttcgg catcgcccgg       540
     gccctcgaag gaaccgcgat cctcaccagc aggatcgccg ggacccccgc ctacatggcc       600
     ccggagcaga tcaccggtgg gccgctcgga ccggccgtcg acatgttcgc ctggggtgcc       660
     accctcgtct acgcggccaa cgggcgcggc ccgttcggcc acggctccct gaaagccgta       720
     gtccagcgag tcatcaacga cgaaccggac ttcggggagc tcagcggcac cctgcgcgaa       780
     atcgcggaac gctgcctgaa caaagacgcc gcccagcggc cgaccgcggc cgaaaccctc       840
     atgctggtgc tcggcatcga agggccgccc ccgactgagg agcccagcac ggacacggcc       900
     atccccgtca cccaccagac cctcgtggcc ggggcgatcg ccgctgccga cacgggagag       960
     caggagagcg ccgcggaact ctaccgctcc tacccgccgg cccctccgcc accgcactcc      1020
     aacgtcgcgg cccagccgtc tccgacgccc ccgccacacc cgcagaccgc cagcggcccc      1080
     cagccttccc tgccctcgac tggtgcacag cactccggat acgggtatgc gaccgggccg      1140
     caccagtccg gatacgggta tgcgaccggt ccccagcagg gcgggtacgc gcccccgccc      1200
     ggaccgcacc agcacgccta tcccaccccc cattccggga atgcggccat cccgccccac      1260
     ggggggccga gcggccccta cgcccccgcc cagccgtgga tgccgtccac cgggggctac      1320
     ccccagacca gccagcccta tagcgggcag cagtaccagc agcaggccga ggggaccagc      1380
     accgcgttcg tgctcggcgt cgtcagcatc gccgtcatcg ccggggtcct gctcttcatc      1440
     ctgctgttcc tgctgatcgg cagcctcggc tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page