(data stored in ACNUC7421 zone)

EMBL: CP000088.PE505

CP000088.PE505       Location/Qualifiers
FT   CDS_pept        573537..575006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0507"
FT                   /product="trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54545"
FT                   /db_xref="GOA:Q47SM2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54545.1"
FT                   /translation="MTDETGRRDIHGEAEDPVTGPAKPPSGPYTGSASGPATAPPASPG
FT                   GMSPGPAWSPIGEQPAASGWNPSAGPGPVRQTPSSHTQTWAVPPGLRNPGPPPDAVHST
FT                   GQWPVFTPGIPAEEPQQRPRRNGMPLWAVLLLVMVVAAGSAGVGGMVGASLVAPEESPP
FT                   PQSSGALNNEVPSDVPSRAPDTIAGVAQRVSPSVVSIRSTSPQLSGNGSGFVIEGNYVV
FT                   TNNHVVDAVRRGGIEVVYSDGHVSRAEVVGAAASSDLAVLKLADPLDVEPLEFGDSDEV
FT                   AVGDTVIAIGAPLGLDGTVTSGIVSALNRPVTVGEDGQEAYLSAIQTDAAINPGNSGGP
FT                   LVNEQGLVIGVNSAIATMSGSSGEQSGSIGLGFAIPSNQASRVVEQLIETGEAPHAVIG
FT                   AILDLRYPEQGALIMEAGRGAETVMRGGPADQAGLRPGDVIVEFDGTTVRDATQLITLI
FT                   HTKAPGDRVEVRYLRNGREHTTTLVLGSSND"
     atgaccgacg agaccggacg ccgcgacata cacggagagg cggaagaccc ggtgacggga        60
     ccggcaaagc ccccgtccgg gccgtacacc ggttccgcgt caggccccgc cacagcaccg       120
     ccggccagcc cgggcgggat gagccccggg ccagcgtggt cgcccatcgg agagcagccc       180
     gccgcatccg gatggaatcc ttccgcgggg ccgggaccgg tcaggcagac tccgtcatcg       240
     cacacccaga cctgggcggt tcctcccgga ctgcgaaatc cggggccccc gcccgacgca       300
     gtccactcca ccgggcagtg gccggtcttc acccccggca tccccgcgga agaaccgcag       360
     cagcggcccc gccggaacgg catgccgctg tgggcggtgc tgctcctcgt catggttgta       420
     gccgcaggat cggcaggtgt cggcggcatg gtgggcgcct ccctcgtcgc cccagaagaa       480
     tccccgcccc cgcagagcag cggcgcgctc aacaacgaag tgcccagcga cgtgccgagc       540
     cgcgcccccg acactattgc cggggtcgcc cagcgggtca gccccagcgt ggtatcgatc       600
     cgcagcacca gcccgcagct cagcggcaac ggctccgggt tcgtcatcga aggcaactac       660
     gtggtgacca acaaccacgt ggtcgacgcg gtgcgccgcg gcgggatcga agtcgtctac       720
     agcgacggcc acgtcagccg ggctgaagtg gtgggcgcgg cagcctcctc cgacttggcg       780
     gtgctcaaac tagcggaccc gttggatgtg gaaccgctgg aattcggcga ctctgatgag       840
     gtagccgtcg gcgacaccgt gatcgcgatc ggcgccccgc tcggactgga cggcacggtc       900
     acctcgggga tcgtcagcgc cctcaaccgc ccggtgaccg tgggggagga cggccaagag       960
     gcctacctca gcgcgatcca gaccgacgcg gccatcaacc caggcaactc ggggggcccg      1020
     ctcgtcaacg agcagggcct ggtgatcggg gtcaactcgg cgatcgccac catgagcggg      1080
     tcgagcgggg agcagagcgg cagcatcggc ctcggattcg cgatcccctc caaccaggcc      1140
     tcgcgggtgg tggaacagct catcgaaacc ggtgaagcac cgcatgccgt catcggcgcc      1200
     atcctcgacc tgcgctatcc ggagcagggc gcgctgatca tggaagcggg ccggggcgcg      1260
     gagaccgtga tgcggggcgg ccccgcggac caggccggcc tgcggcccgg cgacgtcatc      1320
     gtggagttcg acggcaccac ggtgcgggac gccacccagc tcatcaccct gatccacacc      1380
     aaagcccccg gcgaccgggt ggaggtccgc tacctgcgga acgggagaga acacaccacg      1440
     accctggtgc tggggtcgtc caacgactag                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page