(data stored in ACNUC7421 zone)

EMBL: CP000088.PE506

CP000088.PE506       Location/Qualifiers
FT   CDS_pept        complement(575089..576261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0508"
FT                   /product="ATP-binding protein involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54546"
FT                   /db_xref="GOA:Q47SM1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54546.1"
FT                   /translation="MGHLGFRTIDDMSTTPTTEQVNAALATVKDPEIHRPITELDMVKS
FT                   VEIHDDGTVSVGIYLTVAGCPMRGRIEKDVADAVSKVPGVTGVKVTLDVMSDEQRKALQ
FT                   AKLRGGHAEKEIPFAKPNSLTKVFAVASGKGGVGKSSITVNLAAAMAAQGHKVGVVDAD
FT                   IYGHSVPRMLGVSDRPTKVEDMILPPTAHGIKVISIGMFTQGNQAVVWRGPMLHRALQQ
FT                   FLADVYWGDLDVLLMDLPPGTGDVAISVAQLLPNAEILVVTTPQQAAAEVAERAGSISA
FT                   QTHQRVAGVIENMSYYQAPGSDERVYIFGEGGGQAVCDGLSRTLGTKVPLLGQVPLDVA
FT                   LREGGDRGVPLVLDAPDSEAGKVLRSIAEELLGKPRGLAGMMLGLSPTRR"
     gtggggcacc tgggctttcg taccattgat gacatgtcca ccacacccac caccgagcag        60
     gtgaacgcgg ctctggccac cgtcaaggac ccggagatcc accgccccat caccgaactc       120
     gacatggtta aaagcgtcga gatccacgac gacggcacgg tctccgtcgg tatctacctc       180
     acggtggccg gctgtcccat gcgtggccgc atcgaaaagg atgtcgccga cgcagtcagc       240
     aaagtgccgg gggtgaccgg agtcaaggtc acgctcgacg tcatgagcga cgagcagcgc       300
     aaggcgctgc aggccaaact gcgcggtggc cacgcagaga aggagatccc gttcgccaag       360
     ccgaactcac tcaccaaggt gtttgctgtc gcctctggca agggtggggt cggcaagtcc       420
     tcgatcacgg tgaacctggc tgctgccatg gcggcccagg gccacaaggt gggggttgtg       480
     gacgccgaca tctacggaca ctccgtgccg cggatgctgg gtgtcagcga ccgccccacc       540
     aaggttgagg acatgatcct gccgccgacc gcgcacggga tcaaagtgat ttcgatcggc       600
     atgttcaccc agggcaacca ggcggtcgtc tggcgcggcc cgatgctgca ccgcgcactg       660
     cagcagttcc tcgccgacgt ctactggggt gacctggacg tcttgctgat ggaccttccc       720
     ccgggcaccg gtgacgtcgc aatctcggtg gcgcagctcc tgccgaacgc cgagatcctc       780
     gtggtgacca ccccgcagca ggctgcggcc gaggttgccg aacgcgccgg gtcgatctcc       840
     gcgcagaccc accagcgggt cgctggcgtg atcgagaaca tgtcctacta ccaggccccg       900
     ggcagcgacg agcgggtcta catcttcggt gaaggcgggg gccaggcggt ctgcgacggg       960
     ctgtcgcgga ccttgggcac caaggtcccg ctgctgggcc aagtgccgtt ggacgtggcg      1020
     cttcgggaag gcggcgaccg cggtgttccg ctggtgctcg acgccccgga cagtgaggca      1080
     ggcaaggtgc tgcggtcgat cgccgaggag ctgctcggca agccgcgcgg cctggccggc      1140
     atgatgctgg ggttgagccc cacccgccgc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page