(data stored in ACNUC7421 zone)

EMBL: CP000088.PE507

CP000088.PE507       Location/Qualifiers
FT   CDS_pept        576351..577511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54547"
FT                   /db_xref="GOA:Q47SM0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54547.1"
FT                   /translation="MGNVPPPWPSGPDPRERAVPQHSQVWASPGQAAHPGGPDAVWAWP
FT                   PPVKPPRPRVDTPPPGVPYHRMGRTERHRWWKPPLAIGCAIPLSFGLGLFFVLVLELVK
FT                   AIRHIPADVAELGHPVADLAVELVLVIVLLPAVLIAVRVVQRRRAGTLSSVEGRLRWRW
FT                   LLRCTAVAVGCVVVSFGGLMALLVITKPGEPLFGEFAGMETFLAALAVIFLLVPFQAAA
FT                   EEYALRGFLMQLVGGYGDPTRPGRSAPGRLFHRFLASPVPAILVSGLIFTLLHDYYDWA
FT                   LLDVAVFGLGMAWLTWYTGGLEAAIALHVVHNLVAFVLAAYEGDFDSSGDTGSWQSLLA
FT                   TIVEVSVFCLVVAWMRRKQAIRHTTPEAEATPPARPQSPPPSPQWS"
     atgggaaacg tgccaccacc ttggccgtcc ggacccgacc ctcgggaacg ggcggttcca        60
     cagcattctc aggtatgggc atcgcccggc caggcagcgc atccgggggg accggatgcg       120
     gtatgggcgt ggccgccgcc cgtaaaacca ccccggccgc gggtcgacac gccgccgccc       180
     ggtgttcctt atcacagaat gggccgcacc gaacggcacc gctggtggaa accaccactg       240
     gccatcggct gcgcgatccc gctctccttc ggcttgggcc tgttcttcgt gctcgtgctg       300
     gaactggtga aagccatccg gcacatccct gccgacgtgg cggagctcgg ccacccggtc       360
     gccgacctcg ccgtggaact ggtgctggtg atcgtgctgc ttcccgcggt gctgatcgcg       420
     gtgcgggtcg tccagcggcg acgggccggc acgctgtcct ctgtggaggg gcggctgcgt       480
     tggcggtggc tgctgcgctg cactgccgtg gccgtcggat gcgtcgtcgt ctccttcggc       540
     gggctgatgg cgctcctggt gatcacgaaa ccgggagaac cgctgttcgg cgagttcgcg       600
     ggaatggaga cgttcctcgc cgcactggcg gtcatcttcc tgctggtgcc cttccaggcc       660
     gcggctgagg agtacgcgct gcgcggcttc ctcatgcagc ttgtcggcgg ctacggggac       720
     ccgacacggc cggggcgttc cgcgccgggc cgtctcttcc accggttcct cgcctcccca       780
     gtgcccgcga tcctggtcag cggcctgatc ttcaccctgc tgcacgacta ctacgactgg       840
     gcgctgctcg acgtcgcagt gttcggcctg ggcatggcgt ggctcacctg gtacaccggg       900
     ggactggaag cggcgatcgc cctgcacgtc gtccacaacc tcgtggcgtt cgtgctggct       960
     gcctacgaag gagatttcga cagttccggc gacaccggca gttggcagtc actcctcgcc      1020
     acgatcgtcg aagtgagcgt gttctgcctg gtggtggcgt ggatgcggcg caaacaggcg      1080
     atacgccaca ctacgccgga agcagaggcc accccaccgg cacggccgca gtctccccca      1140
     ccgtcccccc agtggtcgta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page