(data stored in ACNUC7421 zone)

EMBL: CP000088.PE508

CP000088.PE508       Location/Qualifiers
FT   CDS_pept        577555..578211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54548"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54548.1"
FT                   /translation="MKTAPTCPRCGRAVHEPDLWSSAWRCDAHGPVTPLRAVRDPSPTS
FT                   LEVVLDEAKVPVWLPWPLPDNWVITGFADVGEERTGTLAAAVALSGPAPLGGLGELVIV
FT                   SEEPGIGLAARIARLDGPDPGNSFDRNPPAAKVRNDGHEIALWSLDGGPERAIYVGEAM
FT                   AQWLWFIFSPADSGVLMCEIDAIHDLRDARDVGPFPTLPFGAPSPFLTESLKPAG"
     atgaagactg cgcctacgtg tccccgctgc ggacgcgccg tccacgaacc tgatctctgg        60
     tcgagcgcgt ggcggtgtga cgcgcacgga ccggtgaccc cgttgcgggc cgtacgggac       120
     cccagtccca cgtctttgga agtcgtactc gacgaagcga aggtgccggt ctggctgccg       180
     tggccgctgc cagacaactg ggtgatcacc gggttcgccg acgtcggcga agaacgcacg       240
     gggacgctcg ctgcagcggt cgccctgtcc ggccccgccc cgctaggcgg gctcggggaa       300
     ctggtgatcg tctccgaaga acccggcatc gggctcgccg cccgcatcgc gcgcctcgac       360
     ggccccgatc caggaaacag cttcgaccgg aacccgcccg cagccaaagt ccgcaacgac       420
     ggacacgaaa tcgccctgtg gtcccttgac gggggaccgg agcgcgccat ctacgtcggc       480
     gaggcgatgg cccagtggct gtggttcatc ttcagccccg ccgacagcgg ggtgctcatg       540
     tgcgaaatcg acgccatcca cgacttgcgc gacgcccgcg atgtcggccc cttccccaca       600
     ctcccgttcg gtgcgccctc cccgttcctc accgagtcgc tgaaacccgc cgggtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page