(data stored in ACNUC7421 zone)

EMBL: CP000088.PE514

CP000088.PE514       Location/Qualifiers
FT   CDS_pept        584219..584461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54554"
FT                   /db_xref="GOA:Q47SL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54554.1"
FT                   /translation="MGSGRHGAARPPIGVLIHRDRVDFSIYGLQAAVTLVIMVLTGPAS
FT                   PVFWLCFLLLFGGVVLFFRRIDRLAREELAESDLL"
     atggggagcg gtcggcacgg agcagcgcgt ccaccgatcg gagtcctgat tcaccgggat        60
     cgagtcgact tctccatcta cggcctgcaa gcagcagtca cactggtgat catggttctc       120
     acgggaccgg cgagcccggt cttctggctg tgcttcctgc tgctgttcgg cggggtcgtc       180
     ctcttcttcc ggcggatcga ccggctggcc cgcgaagagc tcgccgaaag cgacctgctc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page