(data stored in ACNUC7421 zone)

EMBL: CP000088.PE518

CP000088.PE518       Location/Qualifiers
FT   CDS_pept        586794..587954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0520"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54558"
FT                   /db_xref="GOA:Q47SK9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54558.1"
FT                   /translation="MSLPPLVEPADELTIDEVQRYSRHLIIPDVGMDGQKRLKNAKVLV
FT                   VGAGGLGSPTLMYLAAAGVGTLGIIDFDVVDESNLQRQVIHGQSDIGKPKAESARETIE
FT                   EINPFVKVVLHKERLDSSNALEIFADYDLILDGTDNFATRYLVNDAAVLLNKPYVWGSI
FT                   FRFDGQVSVFWNEYGPNYRDLYPEPPPPGMVPSCAEGGVLGVLCATIGSVMANEAIKLI
FT                   TGIGDPLVGRLLIYDALEMTWRTVKIRKDPNAEPITELIDYEAFCGTIPEEAQEAARGS
FT                   TITAKELKEKMDRGEDFFLVDVREKNEYEIVNIPGAVLIPKGEFLTGEAFAKLPQDKQI
FT                   ILHCKSGGRSAEALAAVKKAGFSDAVHVGGGILSWIETVDPSLPKY"
     gtgtcgcttc cgccgctggt cgaaccagcc gacgagctca ctatcgacga ggtacaacgg        60
     tactcgcgcc atctgatcat ccccgacgtc ggcatggacg gtcagaagcg tctgaagaac       120
     gctaaagtcc tggtcgtggg ggcgggcggg ctcggctctc ccacgctgat gtatctggcc       180
     gccgccggtg tgggaaccct gggcatcatc gacttcgacg tcgtggacga gtccaacctg       240
     cagcgccagg tgatccacgg ccagagtgac atcggcaagc ccaaggccga atccgcccgg       300
     gagacgatcg aagagatcaa cccgttcgtc aaggtcgtcc tgcacaagga gcgcctggac       360
     tccagcaacg cgctggagat cttcgcggac tacgacctga tcctggacgg gacggacaac       420
     ttcgccaccc gctacctggt caacgacgcc gccgtcctgc tgaacaagcc gtacgtgtgg       480
     gggtcgatct tccggttcga cggccaggtc agcgtgttct ggaacgagta cgggcccaac       540
     taccgcgacc tgtacccgga accgccgccg cccggcatgg tcccctcctg cgcggaaggc       600
     ggtgtcctgg gcgtcctgtg cgccacgatc ggctcggtca tggccaacga ggcgatcaag       660
     ctgatcaccg gcatcggcga ccccctcgtc ggccggctgc tgatctacga cgccctggag       720
     atgacctggc ggaccgtcaa gatccgcaag gacccgaacg ccgagccgat caccgagctg       780
     atcgactacg aggcgttctg cggcacgatc ccggaagagg cccaggaggc cgcccgggga       840
     tccacgatca ccgccaagga gctcaaggag aagatggacc ggggcgagga cttcttcctc       900
     gtcgacgtcc gggagaagaa cgagtacgag atcgtcaaca tccccggcgc ggtcctcatc       960
     cccaagggag agttcctgac cggcgaggcg ttcgccaaac tgccgcagga caagcagatc      1020
     atcctgcact gcaagtccgg cggacggtcc gccgaggcgc tggccgcggt caagaaggca      1080
     ggcttctccg acgccgtgca cgtgggcggc ggaatcctct cctggatcga aacagtcgat      1140
     ccgagtctcc ccaagtactg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page