(data stored in ACNUC7421 zone)

EMBL: CP000088.PE530

CP000088.PE530       Location/Qualifiers
FT   CDS_pept        604501..604782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0532"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54570"
FT                   /db_xref="GOA:Q47SJ7"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54570.1"
FT                   /translation="MLASVLGSPWLEGVEIPCRSQPDLFFAESPAEVEAAKALCVDCPV
FT                   REQCLAGALERREPWGVWGGQLLVSGKVVARKRPRGRPRKNQTEPIAA"
     atgctcgcgt cggtccttgg gtccccgtgg ttggagggag tcgagatccc ctgccgctcc        60
     cagcccgatc ttttcttcgc tgagtccccg gctgaagtgg aggcagccaa ggcgctgtgt       120
     gtggactgcc cggtgcggga gcagtgcctt gccggtgcgc tcgaacgccg ggagccctgg       180
     ggggtgtggg gcggtcagtt gctggtgagc ggcaaggtgg tcgcccgcaa gcgtccgcgt       240
     ggccgtccgc ggaagaacca gaccgagccg atcgccgcat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page