(data stored in ACNUC7421 zone)

EMBL: CP000088.PE533

CP000088.PE533       Location/Qualifiers
FT   CDS_pept        complement(607424..607981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54573"
FT                   /db_xref="GOA:Q47SJ4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54573.1"
FT                   /translation="MSLHADARAVLASWTAPDADQERLRRAYLDHLDRYPDAMWRSCLP
FT                   GHLTASAAVVDATGQRVLLTLHRKIRLWLQLGGHCEPGDSSLAAAALREATEESGIAGL
FT                   RLLPTPVRLDRHAVPCGGGSWHLDVQYAAVAPPGAEPVVDPAESDGLAWFEVTALPEPS
FT                   DDACRALVAAAVQRVRAAAAAG"
     ttgagcctgc acgctgacgc tcgcgcggtg ttggcgtcct ggaccgcccc ggatgcggac        60
     caagagcggc tgcgccgcgc ctacctggac catctcgacc gctacccgga cgccatgtgg       120
     cggtcgtgcc tgcccggtca tctgacggcg agcgccgcgg tcgtggacgc taccgggcag       180
     cgggtgctgc tcaccttgca ccgcaagata cggctgtggc tgcagttggg gggacattgc       240
     gagcctgggg actcttcgct agctgcggca gcgctgcggg aggcgacgga ggagtcgggg       300
     atcgcgggtc tccgcctgct gcccacgccg gtgcggttgg accggcatgc ggtgccgtgc       360
     ggcggcgggt cgtggcacct ggacgtgcag tatgcggcgg tcgcaccgcc cggcgctgag       420
     cccgtggtgg atccggctga gtcggatggt ctggcctggt tcgaggtgac cgcgcttccg       480
     gagccgtctg atgacgcctg ccgcgctctg gtggccgcgg cggtccagcg ggtccgcgcc       540
     gcggcagcag cggggtag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page