(data stored in ACNUC7421 zone)

EMBL: CP000088.PE537

CP000088.PE537       Location/Qualifiers
FT   CDS_pept        611119..612162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0539"
FT                   /product="secreted protein containing a PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54577"
FT                   /db_xref="GOA:Q47SJ0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54577.1"
FT                   /translation="MVRRAMTLLTSAVLLVGLTVAALAIPVPYVVASPGLALNTLGEID
FT                   GEQVIRIEGQPVYEHDGALSMVTVQYSGGPDSRMNLFTTLSAWLSPTQAVLPEEAIFPP
FT                   NTSAEEVSQTQAAQMDNSQDAAVAAALNELGIDYETTATVHAVNEGYPAEGVLQSGDVI
FT                   VEVDGKPVADKNEVVAAVKDRSPGDTVRFLIERDGQREEVEVGTVASDSGDPIVGITVE
FT                   DTMVFPFEVQISVGRVGGPSAGMMFALGVMDRLDPEGLTGGHRIAGTGTIDPEGNVGGV
FT                   SGVQQKMISAKREGAEYFLVAAESCDQTFDSPVTGQIEVVKVETLKDAVAALENIREGN
FT                   LDDLPRC"
     atggtccgtc gtgcgatgac tctgctcacg tccgccgtcc tgctcgtcgg attgacggtg        60
     gcggcgctcg cgatccccgt cccctacgtg gtggcctctc ccggcctggc attgaacacg       120
     ctcggggaaa tcgacgggga acaagtcatc cggatcgaag ggcagccggt ctacgagcac       180
     gacggggcgc tgtccatggt caccgtccag tactcgggcg gaccggactc gcggatgaac       240
     ctgttcacca ccttgagcgc ctggctctcc ccgacccagg cggtgctgcc ggaagaggcg       300
     atcttcccgc ccaacaccag tgccgaagag gtcagccaga cccaggcggc ccagatggac       360
     aactcccagg acgcggctgt tgccgcggcc ctcaacgagc tggggatcga ctacgagacc       420
     accgcgaccg tgcacgcggt caacgaaggc tacccggccg aaggcgtcct gcagtcaggc       480
     gacgtcatcg tggaggtcga cggcaagccc gtcgccgaca agaacgaggt ggtggcagcg       540
     gtcaaagacc gctcgcccgg ggatacggtc cgcttcctca tcgaacgcga cggccagcgg       600
     gaagaagtcg aagtcggcac ggtcgcttcc gacagcggag accccatcgt cggcatcacc       660
     gtcgaagaca cgatggtctt cccgttcgaa gtgcagatca gtgtcggccg ggtgggcggc       720
     cccagcgcgg gaatgatgtt cgcgctggga gtgatggacc gcctcgaccc ggaagggctc       780
     accggcgggc accggatcgc cgggaccggc accatcgacc cggaaggcaa cgtgggcggg       840
     gtcagcggag tccagcagaa gatgatcagc gccaagcggg aaggcgccga atacttcctc       900
     gtcgccgcgg aaagctgcga ccagactttc gactcgccgg tcaccggcca gatcgaagtg       960
     gtcaaagtgg agacactcaa agacgcagtg gcagcgctgg aaaacatccg cgaaggcaac      1020
     ctcgacgacc tgccccgttg ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page