(data stored in ACNUC7421 zone)

EMBL: CP000088.PE544

CP000088.PE544       Location/Qualifiers
FT   CDS_pept        620917..621774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54584"
FT                   /db_xref="GOA:Q47SI3"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54584.1"
FT                   /translation="MCGRYALGRKKEEIRRVFGLPESEVDAPGADEARRWPPREELAPD
FT                   YNIAPGKHAYAVLGRAPGEPVSGAAGPRHLVTLRWGLVPSWAKDSNVGYRMINARAETV
FT                   TDRPAFRAAFARRRCLLPADAYYEWQLLHTSGEAQPGTSPVTDPEHRSRKAKTRKRPFA
FT                   VRYADDRPLALAGIFERWRDPAVPEEDPAAWLWSFAIITTEAAPELAHIHERMPVVVGE
FT                   EDWATWLDPEADRDDLLSVLDATPVEDFTVYPVGTEVNAVRNNGPHLLVPVSAESEGTS
FT                   ETLF"
     atgtgcggtc ggtacgcgtt gggacgcaaa aaagaagaga tccggcgggt tttcggcctg        60
     cctgagtcgg aggtcgacgc gcccggcgcg gacgaagccc ggcgttggcc gccgcgggag       120
     gagctcgccc ccgactacaa catcgccccc ggcaagcacg cctatgcggt actcggccgt       180
     gccccgggcg agccggtctc cggggcggcc gggccccgtc atctcgtcac actgcggtgg       240
     gggctggtgc cgtcgtgggc gaaggacagc aacgtcggct accggatgat caacgcccgt       300
     gcggagacgg tgacggaccg gccggcgttc cgcgccgcgt ttgcgcgccg ccgctgcctg       360
     ctgccggccg acgcctacta cgaatggcag ttgctgcata cctccggcga agcccagccg       420
     ggcacgtccc cggtgaccga cccggagcac cggtcgcgta aagcgaagac ccgcaaacgc       480
     ccgttcgcgg tccgctacgc cgacgaccgg ccgctcgccc tggcaggcat cttcgagcgg       540
     tggcgggacc cggccgtccc cgaagaagac ccggccgcgt ggctgtggag tttcgcgatc       600
     atcacgaccg aggctgcacc ggagctcgcc cacatccacg agcggatgcc ggtggtcgtg       660
     ggggaggagg actgggccac gtggctagac ccggaggcag accgggatga cttgctgtct       720
     gtgcttgacg ccacaccggt ggaggatttc acggtctacc cggtgggaac cgaggtgaac       780
     gcggtgcgga acaacggtcc gcacctgctc gttccggtgt ccgcggaatc cgaaggaact       840
     tcggagacgc tgttctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page