(data stored in ACNUC7421 zone)

EMBL: CP000088.PE555

CP000088.PE555       Location/Qualifiers
FT   CDS_pept        complement(633163..634098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0557"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54595"
FT                   /db_xref="GOA:Q47SH2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54595.1"
FT                   /translation="MRALFIGNPQATTATPRSRDVIVRALASDMAVDTVLTEYRGHARE
FT                   LVQRAAEEGYDLVVSFGGDGTVNEVVNGILALPAKQRPLYAALPGGSANVFVRALGLPA
FT                   NPVEATGAVLEALHSGSRRTVNLGHIDGPDGGRYFTFCAGFGWDAEVVHEVERQRQRGR
FT                   RATPALYTAIALSLFLRGGMGGDPSLSVEVPGRPPVRNLFFVLVTNTTPWTYAGPSPVQ
FT                   PTPRSRFELDLDVFALTRVDTITTANVLRMMFSAKGVPPRGRGYRTWHNCAEFTIRSQH
FT                   PRPFQIDGEYLGHRQQVNFRSVPKALRIVA"
     gtgcgcgcgt tgttcatcgg gaatcctcag gccacaacgg ctaccccccg ctcgcgcgac        60
     gtcattgtcc gtgcgctcgc cagcgacatg gcggtggaca cggtgttgac ggagtatcgg       120
     ggccatgcgc gggaactggt gcagcgggcc gctgaagagg gctatgacct ggtggtcagc       180
     ttcggcggtg acgggaccgt gaacgaggtg gtcaacggga ttctcgcgct tcctgcgaag       240
     cagcgcccgc tctacgctgc cttgcctggg ggcagcgcga acgtgttcgt ccgtgccctg       300
     ggccttcccg ccaaccccgt ggaggccacc ggcgcggtct tggaggcgct gcacagcggg       360
     tcacgccgca cggtgaatct ggggcacatc gacggaccgg atggcggacg ctacttcacg       420
     ttctgtgcgg ggttcggctg ggacgcggag gtggtccatg aggtggagcg gcagcggcag       480
     cgcgggcgac gggccacccc cgccctgtac accgccatcg cgttgagcct gttcctgcgc       540
     ggagggatgg gcggggatcc ttcgctgagc gtggaggtgc cggggcgtcc tccggtgcgg       600
     aacctgtttt tcgtgctggt gacgaatacg acgccgtgga cgtatgcggg gccgtcgccg       660
     gtgcagccga ctcctcggtc gcgtttcgaa ttggacctgg acgtgttcgc gttgaccagg       720
     gtggacacga tcacgaccgc caacgtgctg cggatgatgt tctccgcgaa aggggtgccg       780
     ccgcggggcc gcggctaccg cacctggcac aactgcgcag agttcacaat ccggtcacaa       840
     caccccagac cattccaaat cgacggagaa tacctcggac accgacaaca ggtcaatttc       900
     cgatcggttc cgaaggcgtt acgaatcgta gcttaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page