(data stored in ACNUC7421 zone)

EMBL: CP000088.PE556

CP000088.PE556       Location/Qualifiers
FT   CDS_pept        634150..634611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0558"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54596"
FT                   /db_xref="GOA:Q47SH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54596.1"
FT                   /translation="MLRAEGPAEQGTKEAGYSEAVSRRPITLLLAAVCEGLLGVLLFIL
FT                   GGYVLVNTLLGNATDVNFALPLAVFAFGGSAALCYVAWGLFHLKEWARTPIVLTQLFAL
FT                   VIAYYLWTSDQVHLSLGLGAFAVLTLLFVLAPPTTATLFPPEGAAKKQR"
     gtgctgcgcg ccgaaggtcc cgcagaacag gggaccaaag aggcaggtta cagtgaagcc        60
     gtgtctcgac gaccgatcac ccttctcctc gcggcagtgt gcgaaggact cctcggagtg       120
     ctgctgttca tcctcggcgg ctacgtcctg gtcaacacac tgctcggcaa cgcgaccgac       180
     gtgaacttcg cgctccctct cgccgtgttc gccttcggcg gcagcgctgc gctctgctat       240
     gtcgcctggg gcctgttcca cctcaaggag tgggcgcgca cccccatcgt gctcacccag       300
     ctcttcgcac tggtgatcgc ctactacctg tggaccagcg accaagtcca cctgagcctc       360
     gggctggggg cgtttgcggt cctcaccctg ctcttcgtgc tcgccccgcc gacgaccgcc       420
     acgctcttcc ccccggaggg cgcggcgaag aagcagagat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page