(data stored in ACNUC7421 zone)

EMBL: CP000088.PE562

CP000088.PE562       Location/Qualifiers
FT   CDS_pept        complement(639198..640052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54602"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54602.1"
FT                   /translation="MARWTIDRPTTHTLDGIVALRVRVVGGHVNILPTDDPATFEISEI
FT                   SGEPLLVSHEAGILTITYADLTRDGLLERLRPIQLGSYRGLPRRSATINLRIPRDCPVE
FT                   VTAATASIVVAQLTAKTQIRNGSGDITLDGVGGDTEINTVSGDVEARNLTGRLGYKSVS
FT                   GDLEIAGGQLSELSAKTASGELLADIDLAPAARVTLGSISGEIALRVPADTSATVELRS
FT                   ATGRLDSAFGLDRQSTRGFTRLSGTIGPGIDPATITTTTVSGATSLLRRAADTPAAIPK
FT                   GDA"
     atggcacggt ggaccatcga ccgaccaacc acacatacct tggacgggat cgtggccctg        60
     cgggtacgcg tcgtcggcgg ccacgtcaac atcctgccca ccgacgaccc ggcgaccttc       120
     gagatctccg aaatctccgg ggagccgctc ctcgtctcgc acgaagccgg gatcctcacc       180
     atcacctacg ccgacctgac ccgggacggg ctcctggaac ggctgcgccc catccagttg       240
     ggcagctacc gtggcctgcc gcggcgcagc gccaccatca acctccgcat tccccgcgac       300
     tgcccggtcg aggtcaccgc ggccaccgcc tcgatcgtgg tggcccaact gaccgcgaaa       360
     acccagatcc gcaacggttc cggagacatc accctggacg gggtaggcgg ggacacggag       420
     atcaacacgg tctccggaga tgtggaggcc cgcaacctca ctggccggct cggctacaag       480
     agcgtcagcg gcgacctgga gatcgcgggc ggccagcttt ccgaactgtc tgccaaaacc       540
     gcttcggggg aactcctcgc cgacatcgac ctggctcctg cagcccgggt cactctggga       600
     agcatctccg gtgagatcgc gctccgggtg ccggccgaca cctcggccac ggtcgagctg       660
     cgctccgcca ccgggcgcct ggactccgcg ttcggcctgg accggcagag cacgcgcgga       720
     ttcacccggc tcagcggaac gatcggcccg gggatcgacc ccgccacgat caccacgacc       780
     actgtctccg gcgccacctc gctgctgcgc cgggctgccg acacgccagc cgcgatcccg       840
     aagggggacg catga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page