(data stored in ACNUC7421 zone)

EMBL: CP000088.PE568

CP000088.PE568       Location/Qualifiers
FT   CDS_pept        647955..651344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0570"
FT                   /product="similar to Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54608"
FT                   /db_xref="GOA:Q47SF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54608.1"
FT                   /translation="MPGGDELSESSRGDTTPRPETEEATVADSSVTNDDVSVDESGVDA
FT                   RADDVDDGSEPEWFASAGESPYLEASAFKDSGSFFRDKVARSLAEEYGIDLDDAGDQTA
FT                   DSAASSGADGQQAQDADTHAGTASPAEDTDQAAAAAAGAEEDEEATEQLRPADAVGGDS
FT                   GGLDEATVQITPTDAADASAVDEEGTTERLSPPSSSGPGADDEATEQINLPSSAAADDE
FT                   ETTERLSPSAARAGDDEATERLDVPASSTAVDAEEATEQLRPADAVGGDSGGLDEATVQ
FT                   IAPVGAVDAEETTERLSPSAARAGDDEATERLDVPASSATVDAEETTERISPVTPTGHG
FT                   SGEETTVQLSPVEAAQSQAAPSTTDPSESTKLETTAVLRENLKSRLRKRPLRPRFRKSA
FT                   AAAGGVGPASPPPPTAPSGTSHSSGPAEKKAPAKKTKRKKPLWWRITRAGLIVIVLLVG
FT                   LVTGAFAYAYSMFEVPDAAQADATAQGSIFYYADGSVLTERGVNRKPVSLDEVPEHVQN
FT                   AILSAENRGFWDEPGVSITGTARAVWSTVTGKQLQGGSTITQQFVRNYYEGLSQEQTIE
FT                   RKLKEIIIALKVDRSQSKEWILEQYLNTIYFGRNAYGIQAAAEAYYDKDVGDLTPDEAA
FT                   FLAAAIQQPTKFGFADSDTTPEMESRWQYVVNGLVDMGSITEAEAAEYKFPKPLPERPQ
FT                   DNIDLSGYKGYMFQQAMKELEELGYTEDNINRGGYEIHTTFDPKLMELAYEAVQETVPI
FT                   DDLPEGVRVGLSVVDPKTGGVLAFYGGEDYFENQYDSAFLGTAQAGSAMKPYVLAAALK
FT                   EGLSLHTVVDGRGPRYINGTRIQNAGNAPGGPMNLIQATAVSNNLGYIDLAQRVGLEKV
FT                   AETAYAMGLPEGSIDLVPVLPLGANSVSPTDQAGGYATFANGGEHIETHVVASIINKEG
FT                   EEERPEPKRNRVLTKEQAADATYAMRQVITSGTGTAANIGRPAAGKTGTTDGSVAAWFV
FT                   GYTPQLSAAVGIYSGDNQRFYVPGWGTLSGGTLPATVWRTFMQKALADKPVEDFPSPSF
FT                   GGSAQNWAPQPEPSTPADTPQDQGPNQDGLNPAPEPEVPQPAPEPVVPEPVVPEPVVPE
FT                   PVVPEPGGPDPGFPGGGLPPSG"
     atgccagggg gcgacgaact gagcgagagc agtagaggcg acaccactcc gcgccctgag        60
     accgaggaag cgactgtcgc cgattcttcc gtaacgaacg acgatgtgag cgtcgacgag       120
     tctggcgttg acgctcgtgc tgacgatgtc gacgacggga gcgaacccga atggttcgct       180
     tccgctgggg aatcccctta cctcgaggcc agcgcgttca aagacagcgg cagtttcttt       240
     agagacaagg ttgcccgcag cctggccgaa gagtacggga tcgatctcga cgacgccgga       300
     gaccagaccg cggactccgc agccagtagc ggagcagacg gccagcaggc ccaggacgca       360
     gacacgcatg ccgggaccgc gtctcccgcc gaggacaccg accaggctgc agcggctgcg       420
     gctggtgcag aggaggacga ggaggcgacg gagcagctcc gcccggctga tgctgtgggc       480
     ggcgattctg gtggtcttga tgaggccacg gtgcagataa ccccgacaga tgcggcggat       540
     gcgtctgcgg tggacgagga agggaccact gaacggctca gcccgccgtc ctcctccggc       600
     cccggggcag acgacgaagc caccgaacag atcaacctgc cgtcgtcggc cgcggcggac       660
     gacgaagaga ccacggagcg gctcagtccg tctgctgcac gagcgggaga cgacgaggcc       720
     acggaacggc ttgatgtgcc agcctcctct accgcggtgg atgcggagga ggcgacggag       780
     cagctccgcc cggctgatgc tgtgggcggc gattctggtg gtcttgatga ggccacggtg       840
     cagatagccc cggtaggtgc ggtggatgcg gaggagacca ccgaacggct cagtccgtct       900
     gctgcacgag cgggagacga cgaggccacg gaacggcttg atgtgccagc ctcctctgcc       960
     acggtggatg cggaggagac caccgaacgg atcagccccg tcacccccac cggtcacggc      1020
     agcggcgaag agaccacggt ccagctctcc ccggtagagg cagcgcagag ccaggccgca      1080
     ccctccacga ccgacccctc cgagagcacc aagctcgaaa ccaccgcggt cctccgcgag      1140
     aacctgaaat cgcggctccg gaagcgcccc ctccgtccgc ggttccggaa gtcggctgct      1200
     gccgcaggcg gtgtgggacc cgccagtccg cctcccccca ccgccccgtc gggaacctcg      1260
     cactccagcg gccccgcgga gaagaaggca ccagcgaaga aaaccaagcg gaagaaaccg      1320
     ttgtggtggc ggatcacccg cgccggactg atcgtcatcg tgctgctcgt ggggctggtg      1380
     accggcgcat tcgcctacgc ctactcgatg ttcgaggtcc ccgacgcagc ccaggccgac      1440
     gcgactgcgc agggctccat cttctactac gccgacggat cagtcctcac cgaacgcggc      1500
     gtcaaccgta aaccggtctc cctcgacgag gttcccgagc acgtccagaa cgccatcctc      1560
     tccgcggaga accgcgggtt ctgggacgag ccgggcgtgt ccatcaccgg tacggcgcgt      1620
     gcggtgtggt ccaccgtcac tggaaagcag ctccagggcg gatccaccat cacccagcag      1680
     ttcgtccgca actactacga agggctcagc caggagcaga ccatcgagcg caaactcaag      1740
     gagatcatca tcgcgctcaa ggtcgaccgc tcccagagca aggagtggat cctggagcag      1800
     tacctcaaca ccatctactt cggacggaac gcctacggca tccaggcggc cgcggaagcc      1860
     tactacgaca aggatgtcgg cgacctcacg ccggatgagg cggcgttcct cgccgcagcc      1920
     atccagcagc ccaccaagtt cggcttcgcg gacagcgaca ccactcctga gatggagagc      1980
     cgctggcagt acgtggtcaa cggcctggtg gacatggggt cgatcactga agccgaggcg      2040
     gcagagtaca agttccccaa acccctgccg gaacggccgc aggacaacat cgacctcagc      2100
     ggctacaagg gctacatgtt ccagcaggcc atgaaggagc tggaggagct cggctacacc      2160
     gaggacaaca tcaaccgggg tggctacgag atccacacca ccttcgaccc caagctgatg      2220
     gagctggcct acgaagccgt gcaggagacc gtgcccatcg acgacctccc cgaaggggtg      2280
     cgggtcgggc tcagcgtggt cgatccgaag accggcgggg tgctggcctt ctatggcgga      2340
     gaggactact tcgagaacca gtacgacagc gcgttcctcg gcaccgcgca ggcagggtcg      2400
     gcgatgaagc cgtacgtgct ggccgcagcc ctcaaggaag ggttgagcct gcacacggtg      2460
     gtggacggcc gcggcccccg gtacatcaac ggcacgcgga tccagaacgc gggcaacgcc      2520
     cccggtggtc cgatgaacct catccaggcc accgcggtct ccaacaacct cggctacatc      2580
     gacctcgctc agcgggtcgg actggagaag gtcgcggaaa ccgcctacgc catggggctg      2640
     cccgaaggaa gcatcgacct ggtgccggtg ctgccgttgg gcgccaacag tgtgagcccc      2700
     accgaccagg cgggcggcta cgcgactttc gccaacggcg gcgaacacat cgagacccac      2760
     gtggtcgctt ccatcatcaa caaggaaggt gaagaggaac gccccgagcc gaaacgcaac      2820
     cgggtgctca ccaaggagca ggcagcagac gccacctacg caatgcgcca ggtgatcacc      2880
     tccggtaccg gaacggccgc caacattggg cgtccggcag cgggcaagac cgggaccacc      2940
     gacggaagcg tggccgcctg gttcgtcggc tacaccccgc aattgtctgc cgcggtgggc      3000
     atctacagcg gcgacaacca gaggttctac gtgccgggct ggggcaccct gtccggcggt      3060
     acgctcccgg cgaccgtgtg gcgcacgttc atgcagaagg cgctggcgga caagccggtg      3120
     gaggacttcc cgtcgccctc gttcggcgga tccgcgcaga actgggcgcc ccagccggag      3180
     ccgagcacgc ctgcggacac cccgcaggac cagggcccga accaggacgg cctgaacccg      3240
     gcgcccgagc ctgaagtacc gcaaccggct cccgaacctg tggtgcctga gcctgtggtg      3300
     cccgaaccgg ttgttccgga acccgtggtg cccgagccgg gaggcccgga tcctggtttc      3360
     ccaggagggg ggctacctcc gtcaggctga                                       3390
//

If you have problems or comments...

PBIL Back to PBIL home page