(data stored in ACNUC7421 zone)

EMBL: CP000088.PE569

CP000088.PE569       Location/Qualifiers
FT   CDS_pept        complement(651406..652500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54609"
FT                   /db_xref="GOA:Q47SF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54609.1"
FT                   /translation="MNRHDLPELPGVLRADEIARSAAYLLHAQEPSGAIPWFPGGHLDV
FT                   WDHIECAMALSTVGHYTAAVRAYDWLAAVQHPDGSWPAKLRQGTVVNPLREANHASYLA
FT                   VGVWHHFLVTGDDAFLERLWPTVRAGIGFVLGLRTERGEILWARDADGSPGDHALLTAC
FT                   ASIHHALRCAIALADHLDHPQPDWELAAARLAHLICEHETVFADRSRYSMDWYYPILGG
FT                   AMRGARAEKRIAERWDTFVVPGLGIRCVSDQPWVTGAETSELVLALAAIGSRDRGAELL
FT                   ASIQHLRDPDDGAYWTGYQFVEDVRWPVERSTWTTAAVILAVDALCGATPGSQVFTRIP
FT                   RAAEQSAEGCCDQPVVLPAEAGLA"
     atgaaccggc acgaccttcc cgagctgccg ggtgtcctcc gggccgacga gatcgcgcgc        60
     agcgccgcct acctgctcca cgcccaggag ccttcggggg cgatcccgtg gttccccggc       120
     gggcacctcg acgtgtggga ccacatcgaa tgcgccatgg cgctgtccac cgtcggccac       180
     tacacggcag cggtgcgcgc ctacgactgg ttggcggcag tgcagcaccc ggacgggtcc       240
     tggcccgcaa aactgcggca aggcactgtc gtcaacccgc tgcgggaagc caaccacgcc       300
     tcctacctgg ccgtcggcgt ctggcaccac ttcctggtca ccggggatga cgcgttcctc       360
     gaacggctct ggcccaccgt gcgtgccggg atcggtttcg tgctcggcct gcgcaccgaa       420
     cgcggcgaga tcctctgggc gcgggacgcc gacgggtccc ccggcgacca cgcgctgctc       480
     accgcttgcg cgagcatcca ccatgcgctg cgctgcgcaa tcgcgctcgc cgaccacttg       540
     gaccaccccc agccggactg ggagctggct gctgcccgcc tcgcccacct gatctgcgaa       600
     cacgaaaccg tgttcgctga ccgcagccgc tattccatgg actggtacta cccgatcctc       660
     ggcggggcga tgcgcggcgc ccgagcggag aaacgtatcg cggagcgctg ggacacgttc       720
     gtcgtccccg gcctcggcat ccgctgtgtc agcgaccagc cgtgggtgac aggggctgaa       780
     acatccgaac tggtgctcgc cctggcagcg atcggcagcc gggaccgcgg tgctgaactg       840
     ctcgcctcga tccagcacct ccgcgacccg gacgacggcg cctactggac gggctaccag       900
     ttcgtcgaag acgtgcggtg gccggtggaa cgcagcacgt ggacgacggc ggcggtcatc       960
     ctggcggtgg acgccttgtg cggggccacg ccgggctccc aggtcttcac ccgtatcccc      1020
     agggctgcgg agcagagcgc cgaagggtgc tgcgaccagc cggtcgtgct ccccgcggaa      1080
     gccggtctcg cctag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page