(data stored in ACNUC7421 zone)

EMBL: CP000088.PE570

CP000088.PE570       Location/Qualifiers
FT   CDS_pept        complement(652497..653228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54610"
FT                   /db_xref="GOA:Q47SF7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54610.1"
FT                   /translation="MITIDFTLFPVGPGHRVLDLGCGGGRHAFEVYRRGADVVAFDQNA
FT                   EDLAAVSAMFAAMRAEGEAPAEATAETVRGDALAMPFDDNTFDRVIAAEIMEHIPHDTA
FT                   AMAEMYRVLRPGGIAVVTVPSWFPERICWALSEEYHTVEGGHIRIYTRAELEAKLKATG
FT                   FIIGPHHHAHALHSPYWWLKCAVGTTNDSHPLVRAYHNLLVWDMLKAPRITRVTERLLN
FT                   PLIGKSVVVYLRKPRNDGDTG"
     ctgatcacca tcgacttcac cctgtttcct gtcggccccg gtcaccgggt tctggacctg        60
     ggctgcggtg gcggccggca cgcgttcgag gtctaccgcc ggggcgccga cgtggtggct       120
     ttcgaccaga acgcggaaga cctggctgcg gtctccgcca tgttcgccgc catgcgcgcc       180
     gaaggagaag cccccgctga ggccaccgcc gagacggtgc gcggggacgc gctcgccatg       240
     cccttcgacg acaacacgtt cgaccgggtc atcgcggccg agatcatgga gcacatcccg       300
     cacgacaccg ctgccatggc cgagatgtac cgggtcctcc gccccggggg gatcgccgtc       360
     gtcaccgtgc cgagctggtt cccggagcgg atctgctggg cgctgtccga ggagtaccac       420
     accgtcgaag gcggccacat ccgcatctac acgcgtgcgg aactggaagc caaactcaaa       480
     gccacggggt tcatcatcgg cccgcaccac cacgcgcacg ccctgcactc cccctactgg       540
     tggctcaaat gcgcggtggg caccaccaac gactcccacc cgctcgtccg cgcctaccac       600
     aaccttctgg tgtgggacat gctcaaagcc ccccgcatca cccgggtcac cgaacgcctc       660
     ctcaacccgc tgatcggcaa aagcgtcgtg gtctacctgc gtaaaccccg gaatgatggg       720
     gacaccggat ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page