(data stored in ACNUC7421 zone)

EMBL: CP000088.PE572

CP000088.PE572       Location/Qualifiers
FT   CDS_pept        complement(654946..656379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0574"
FT                   /product="similar to DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54612"
FT                   /db_xref="GOA:Q47SF5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54612.1"
FT                   /translation="MTAPQRPERQQISEDHAFALLLRQGEGYERCYDAFAPALYRYCWT
FT                   LLGAEQEDAAAEAVYETFLAAVELLPRLSDPDLFRAWLFALARAACERHGFAAQPAYAH
FT                   LTVHSEQQPFVAALSALLPSQRELLELSLRHGLTHTQIAAVLGLDPETVSDLCRSAAQQ
FT                   AADLLTEQQPGGSPGSRWFIADIPLVVSSIALPGPPRSLRARVIADCSDATAITRREQA
FT                   AALLCPLGANGFPLPGARGAEAEAAEPVQADAAVPAASASEADASPAAAEPETTDSAIA
FT                   GEPHRLSGWLVPATAGLVTALVAFSLWGLGAFTNRPGNGTAAGTPPPVDGVSVAPMSDH
FT                   VPASAAPDTGKVPSIELTEPTLEPTPEEPVEPVAPDSVEDDTAEPAAPPAEPDPAPPAS
FT                   EDAATVDPPAPAPQQPAPAPREEPASQPQPAPTAPAAPAPAPAPAQPAQEDPPPRRPGS
FT                   GVISLLEGVLGLLGLHGNR"
     ttgacagcgc cgcagagacc ggagcgtcag cagatcagcg aagaccacgc gttcgccctg        60
     ctgctgcggc agggcgaagg gtacgaacgg tgctacgacg ctttcgcacc cgcgctctac       120
     cgctactgct ggaccctgct cggcgccgag caggaggatg ctgcggcgga agccgtctac       180
     gaaaccttcc tggctgccgt cgaactcctc ccccgcctgt ccgatcctga cctgttccgg       240
     gcctggctgt tcgcgctcgc ccgggccgcc tgcgagcggc acggattcgc cgcgcagccc       300
     gcgtatgcgc acctcaccgt ccacagtgag cagcagcctt tcgttgccgc gctgagcgcc       360
     ctcctcccca gccagcggga actgctggag ctctccctgc ggcacgggct gacccacacc       420
     cagatcgctg ccgtcctggg cctcgaccct gaaacggtga gcgacctctg ccgctccgca       480
     gcccagcagg ccgcagacct actcaccgag cagcagcccg gcggcagtcc aggatcccgg       540
     tggttcatcg cggacattcc cctggtcgtg agctctatcg cgctgcccgg cccgccgcgt       600
     tccctgcgcg cccgagtcat cgccgactgt tcggacgcca ccgcaatcac gcggcgggag       660
     caggctgctg ccctgctctg cccgctcgga gccaacggct tcccgctgcc gggggcgcgc       720
     ggcgcggaag cggaggcagc cgagcccgtc caggccgacg cggccgtccc cgcggcctcc       780
     gcatctgagg cggacgcctc cccggctgcc gccgagcccg aaaccacgga cagcgctatt       840
     gcgggggagc cgcaccggct ctccggctgg ctggttcccg ccaccgccgg tctcgtcacc       900
     gcgctggtcg cattcagcct gtggggcctg ggcgcgttca cgaaccggcc cgggaacgga       960
     accgcggccg ggaccccgcc cccggtggac ggggtgagtg tcgcccccat gtccgatcac      1020
     gtccccgcga gcgccgcccc ggacacgggc aaggtgcctt ccatcgaact caccgagccg      1080
     acactggagc ccacaccgga agaacccgtc gaaccggtgg caccggacag cgtcgaggac      1140
     gacactgccg aacccgccgc cccgccagca gagcccgacc cagcgcctcc tgccagcgaa      1200
     gacgcggcaa cggtcgaccc tcccgcgcct gctccgcagc agcctgcccc ggcaccgcgc      1260
     gaggaaccgg ccagtcagcc ccagcctgct cccacggcgc ctgccgcccc cgcgccggca      1320
     ccggctcccg cccagcccgc ccaggaagac ccgccgccgc gccgcccggg aagcggcgtg      1380
     atctcgctcc tcgaaggagt cctggggctc ctcggcttgc acggcaaccg ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page