(data stored in ACNUC7421 zone)

EMBL: CP000088.PE580

CP000088.PE580       Location/Qualifiers
FT   CDS_pept        complement(663757..666006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0582"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54620"
FT                   /db_xref="GOA:Q47SE7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54620.1"
FT                   /translation="MTARPAVRQPAGLPCPQPCNRYGYPMTNALLAEIDALVAGTHHNP
FT                   HALLGAHPGPEGVWVRALRPLARSVHVLLANGSRVELPHLHKGVFAGVVPGAEVPDYRL
FT                   VVRYDDGTELTVDDPYRHLPTLGELDIHLIQEGRHEELWRVLGAHTKRFPSVLGDTEGT
FT                   AFTVWAPNARGVRVIGDFNHWDGTGHPMRSLGSCGVWELFIPGVGDGTRYKYQVLGADG
FT                   VWREKADPVAFATQAPPETASVVFTSRYTWQDDEWLTQRAAADLHRKPMSIYEVHLGSW
FT                   RPGLSYRELADQLVDYVRELGFTHVEFLPVAEHPFGGSWGYQVTSYYAPTARFGSPDDF
FT                   RYLVDRLHQAGIGVFLDWVPAHFPKDDWALSRFDGTALYEHPDPRRGIHPDWDTLIFNY
FT                   GRTEVRNFLVANALFWLEEFHIDGLRVDAVASMLYLDYSRESGQWEPNAYGGRENLDAI
FT                   DFLRELNATAYRRNPGIAMIAEESTAWPGVTRSTDTGGLGFGFKWNMGWMHDTLSYLQH
FT                   DPVHRQYHHNEVTFSMVYAYSENYVLPLSHDEVVHGKRSLLYKMPGNEWQRCANLRALL
FT                   AYMWAHPGKQLLFMGNEIAQGDEWSHDAGVQWWLLRYPHHAGMRRLVADLNRLYRNTRA
FT                   LWSQDTVPEGFTWLDGGDASGNTLSFLRWGDDGSVLACLVNFSGRPHPERRVGLPYAGR
FT                   WREILNTDAVLYGGSGVSQPGIIEASEETPWQGQPASALVTYPPLGVSWLVFDGT"
     gtgaccgccc ggcctgcagt ccgccaaccc gctggcctgc cctgcccgca accctgcaac        60
     cggtacggat atccgatgac caacgcactc ctcgctgaaa tcgacgccct ggtcgctggc       120
     acccaccaca acccgcacgc cctgctcggc gcgcatcccg gcccggaagg ggtgtgggtg       180
     cgtgccttgc gcccgctcgc ccgctccgtg cacgtgctcc tcgccaacgg cagccgggtc       240
     gaacttcccc acctgcacaa aggcgtgttc gccggggtgg ttccgggtgc cgaagtcccc       300
     gactaccggc tggtggtgcg ctacgacgac ggcaccgagc tcaccgtgga cgacccctac       360
     cggcacctgc ccactctcgg agagctcgac atccacctca tccaggaagg gcggcacgaa       420
     gaactgtggc gcgtgctcgg cgcgcacacc aaacgcttcc cttctgtcct gggcgacacg       480
     gaagggaccg cgttcaccgt gtgggcgccc aacgcccgcg gggtacgggt gattggggac       540
     ttcaaccact gggacggcac tgggcacccc atgcgttcgc tcggctcctg cggggtgtgg       600
     gagctgttca tccccggggt cggcgacggt acccggtaca agtaccaggt gctcggcgcc       660
     gacggagtgt ggcgggagaa agccgacccg gtggcgttcg ccacccaggc gccgccagag       720
     accgcgtccg tggtgttcac ctcccgctac acctggcagg acgacgagtg gctgacgcag       780
     cgcgccgccg ctgacctgca ccgcaagccg atgagcatct acgaggtgca cctcggttcg       840
     tggcggcccg gcctgtccta ccgggagctt gccgaccagc tcgtggacta cgtccgcgag       900
     ctggggttca cgcacgtgga attcctgccg gtcgcggagc acccgttcgg cggctcgtgg       960
     ggctaccagg tcacctccta ttacgcgccc accgcccggt tcggctcccc cgacgacttc      1020
     cggtacctgg tcgaccgcct ccaccaggcg gggatcgggg tgttcctgga ctgggtgccc      1080
     gcgcacttcc cgaaagacga ctgggcgcta tcccgcttcg acggcaccgc cctgtacgag      1140
     cacccggacc cgcgccgcgg catccacccc gactgggaca cgctgatctt caactacggc      1200
     cgcaccgagg tccgcaactt tctggtcgcc aacgcactgt tctggctgga agagttccac      1260
     atcgacgggc tgcgcgtgga cgcggtggct tccatgctct acctggacta ctcccgggag      1320
     tccggccagt gggagcccaa cgcctacggc gggcgggaga acctggatgc catcgacttc      1380
     ctgcgggagc tcaacgccac cgcctaccgc cgcaaccccg gaatcgcgat gatcgccgag      1440
     gaatccaccg cctggcccgg ggtgacccgc agcaccgata cgggagggct cggcttcggg      1500
     ttcaagtgga acatggggtg gatgcacgac accctgtcct acctgcagca cgaccccgtc      1560
     caccggcagt accaccacaa cgaagtcacc ttctccatgg tgtacgccta cagcgagaac      1620
     tatgtgctgc cgctctccca cgacgaagtc gtgcacggca agaggtcgct gctgtacaag      1680
     atgccgggga acgagtggca gcgctgcgcg aacctgcggg cgctcctggc ctacatgtgg      1740
     gcgcacccag gcaaacagct cctgttcatg ggcaacgaga tcgcccaagg cgacgagtgg      1800
     tcgcacgacg ccggggtgca gtggtggctg ctgcgctacc cccaccatgc cgggatgcgc      1860
     cggctcgtcg ccgacctcaa ccggctgtac cggaacacgc gggcgctgtg gagccaagac      1920
     acggtcccgg aggggttcac ctggttggac ggcggtgacg cgagcggcaa cacgctgtcg      1980
     tttctgcggt ggggagacga cgggtcggtc ctggcctgcc tcgtgaactt cagcggccgc      2040
     ccgcacccgg agcgccgggt cggcctgccc tatgcgggcc ggtggcggga gatcctcaac      2100
     acggacgccg tgctttacgg cggcagcggc gtctcgcagc cggggatcat cgaggcctcc      2160
     gaggagacgc cgtggcaggg ccagcccgct tccgctctgg tgacctaccc gccgctgggg      2220
     gtgtcctggc tggtgttcga cgggacgtga                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page