(data stored in ACNUC7421 zone)

EMBL: CP000088.PE594

CP000088.PE594       Location/Qualifiers
FT   CDS_pept        complement(685117..686271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54634"
FT                   /db_xref="InterPro:IPR016097"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54634.1"
FT                   /translation="MALFRRRRSDESAVAIDDFWSGWGELRSALAASIDEGAPVPAEVA
FT                   QQLDERVQRIHPSLTWEVSRAPEPAPTNLASSPFESLDSPEALLASLDAEPASARASYA
FT                   LTLRAGDDDEARVLAERWYRAAPEDAEWTFFPARPADHAQLSRTITWHDHELDLSHVSV
FT                   SMRVNHATGKIEAGVYHPDFMFLPEETQREVAEHVMLLAVGEDDMVRWVDSVKPLVEKP
FT                   LDPLPPTSVPAVVRQLSGMSGGGGWVTLQGRIPLRGAMQLSARHPLHRRDYPALTLYVQ
FT                   VVASYTEADKDRLPTGSSAAALESYALRLREMLGANGALFAVQTLGGQRVFHFYLDPES
FT                   GIFPEFEKAAREWSEGQASVTSELDPEWRIIEQLLKPIRKQLGR"
     atggctctgt tccgtcgccg ccgctccgac gagtccgctg tcgccatcga cgacttctgg        60
     tccgggtggg gtgagctccg cagcgctttg gccgcgtcca tcgacgaagg ggccccggtt       120
     cccgccgagg tcgcccagca gctcgatgag agggtgcagc gtatccaccc ctccctcacc       180
     tgggaggtgt cgcgcgcacc tgaacccgcg cccaccaacc tcgcctcctc cccgttcgag       240
     tccctggaca gcccggaagc gctcttggcc agcctggacg ccgaaccggc ctccgcacgc       300
     gcctcatatg cgctaacctt gcgggccggg gacgacgacg aggcccgcgt gctcgcggaa       360
     cgctggtacc gcgccgcgcc ggaggacgcc gagtggacgt tcttcccggc ccgtcccgcc       420
     gaccacgccc agctgtcccg cacgatcacg tggcacgacc acgagctcga cctgtcgcac       480
     gtctcggtgt cgatgcgggt gaaccacgcc accgggaaga tcgaggcggg cgtctaccac       540
     cctgacttca tgttcctccc ggaggagacc cagcgcgagg tcgccgagca tgtgatgctg       600
     ctggctgtcg gcgaagacga catggtgcgc tgggtcgact cggtcaagcc gctcgtggag       660
     aaacccctcg acccgctccc cccgacgtcg gtgcctgccg tggtccggca gctctccggg       720
     atgagcgggg gaggcggatg ggtcaccttg caggggcgga ttccgctgcg gggcgccatg       780
     cagttgtcgg cacgccatcc cctgcaccgc cgcgactatc ccgcgctcac cttgtacgtc       840
     caagtggtgg cctcctacac ggaggcagac aaggaccgcc tgcccacggg ctcctcagcg       900
     gcggccttgg agtcctacgc cttgcggctg cgggaaatgc tcggcgccaa cggtgccctg       960
     ttcgcggtgc agactctcgg cggtcagcgg gtcttccact tctacctcga cccggagtcg      1020
     ggcatcttcc ccgagttcga gaaggctgcc cgggagtggt cggaaggcca ggcctccgtc      1080
     accagtgaac tggaccctga gtggcgcatt atcgagcagc tcctcaaacc catccgcaag      1140
     cagttggggc gctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page