(data stored in ACNUC7421 zone)

EMBL: CP000088.PE597

CP000088.PE597       Location/Qualifiers
FT   CDS_pept        688296..689051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54637"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54637.1"
FT                   /translation="MCPWGRLLTPRLSVTVSASLEGVAPPMQGLTYGVDIVLCIDATGS
FT                   MSPIIDRVKESALRFHEDLRKVMAAKSKNIDSLRVRVIAYRDYYCDAPEEAMVTSEFFS
FT                   LPQQAAEFSRFVNGIEARGGGDEPETGLEALALAMRSDWDTKSRKRRQIIVVWTDASVH
FT                   PLEKNAGDKPDGYPQDIPEDFDELTDMWEGQEYMDASAKRLILYAPDALGWTEIANHWE
FT                   NVIHFPSQGGNGLEEVDYSTILDTIANSI"
     atgtgtccgt ggggccgact cctcacaccg aggctttccg taacggtttc cgcatcactg        60
     gaaggggtcg caccacccat gcagggtttg acctacggcg tcgacatcgt cctgtgcatt       120
     gatgccaccg gaagcatgag ccccatcatc gaccgggtaa aagaaagtgc cttgcgcttt       180
     catgaagact tgcgcaaggt tatggcggct aagagcaaga acattgactc cctacgggtc       240
     cgcgtcatcg cctaccgcga ctactactgc gacgctccag aagaggcgat ggtcacgtca       300
     gagttcttct ctcttcccca gcaggccgcg gaattttccc ggtttgttaa cggcatcgaa       360
     gctagaggtg gcggagacga accggagacc ggtttggaag ctctcgcgtt ggcgatgcgg       420
     tcagactggg ataccaagag tcgcaaacgc cgccagatca ttgtggtctg gaccgatgcg       480
     agcgtccacc cgcttgagaa gaacgccgga gacaaaccgg atggctatcc ccaggatatc       540
     ccggaggact tcgatgaact gaccgacatg tgggaaggac aggagtacat ggatgccagc       600
     gccaagcggc tcatcctcta cgcccccgat gctctgggat ggactgaaat cgctaatcac       660
     tgggaaaacg tcattcactt cccttctcaa ggcggtaatg ggctggaaga agtggactac       720
     tcaacgatcc tcgacaccat tgccaacagc atctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page