(data stored in ACNUC7421 zone)

EMBL: CP000088.PE599

CP000088.PE599       Location/Qualifiers
FT   CDS_pept        690111..691193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0601"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54639"
FT                   /db_xref="GOA:Q47SC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54639.1"
FT                   /translation="MSEFIGKYRIITDFTTSGGGQCRWAFAVHGGKEYFIKEFLSPTYP
FT                   LPDSPGSKATKERKLRKCEQFEKHHREITKTLKRLSKPGGNLVITQDFFRHGAKYYKVT
FT                   EKIDTSALSLEEIAAEPMERRLLMLITVTHSLKILHQAGLVHGDIKPENILIKGTVKNY
FT                   HTAKLIDFDNAFFSGKPVPPDDMVGDLNYYSPETFGYLNGTVMGEQLTTASDIFALGLV
FT                   AVQFLTGSLVSFIPVEGAGRYPGELCAAGASYTTGLEEIFPQADSFVRKMLSAEPSKRP
FT                   TVDQVFDHVKELRSEVKKREDFITTTIVPRASSAKKSRLKGTLLKKSASTSREAEPTPR
FT                   NEKRSRLRGTLLEKRDSPPA"
     gtgagcgaat ttatcgggaa ataccgtatt attactgatt tcaccacgtc tggtgggggg        60
     cagtgccgct gggcgttcgc tgttcatggc ggaaaagagt atttcatcaa ggaatttctc       120
     tcccctacct atccgctgcc tgactcgccc ggttctaaag caacgaaaga gcgtaagctc       180
     cgtaaatgtg aacagtttga aaaacaccac cgagaaatta ctaagaccct gaagaggctc       240
     tccaagccgg gggggaacct ggtgatcacc caggacttct tccggcatgg cgccaagtat       300
     tacaaggtga cggagaagat cgacaccagt gcgcttagcc tagaagagat cgccgcagag       360
     ccgatggagc gccgtctcct gatgctgatc accgtcaccc actccctgaa gatcctgcac       420
     caggcgggac tggttcacgg ggatatcaaa cctgagaata tcctcatcaa gggcacagtc       480
     aaaaactacc acaccgctaa actcatcgac ttcgacaacg cctttttttc tggaaaaccg       540
     gtacccccgg acgatatggt gggtgatctc aactattact ctcccgaaac attcggttac       600
     ctcaacggaa cagttatggg agagcagctc accacagcct ctgacatctt tgcgctcggc       660
     cttgtcgccg tccagttcct caccggatca ctggtgtctt tcattccagt ggaaggagca       720
     ggacgttatc caggagagtt gtgtgcggca ggagcgtcct acaccactgg cttggaagaa       780
     atattccctc aagcagattc ctttgtccgt aaaatgctct cggcggaacc aagtaaaagg       840
     ccgactgtag accaagtttt cgatcatgtt aaagagctgc gttcggaggt gaaaaagaga       900
     gaagacttca taactacaac gattgtcccg agggcctcga gtgcgaaaaa atctcgcttg       960
     aaaggcactc ttctcaagaa gagtgcctca acttctcggg aagcggaacc taccccacgg      1020
     aatgagaaaa gaagtcgact gcgtggcaca cttctcgaga aacgggattc gccgccagca      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page