(data stored in ACNUC7421 zone)

EMBL: CP000088.PE604

CP000088.PE604       Location/Qualifiers
FT   CDS_pept        697648..699144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0606"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54644"
FT                   /db_xref="GOA:Q47SC3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54644.1"
FT                   /translation="MTELLKLSAAELGAAIASGETSAVEATQAYLDRIAEVDGQIHAFL
FT                   HVAADKALEQARAVDARRAAGEKLGPLAGVPVAHKDVFTTKDMPTTAASKILEGWQSPY
FT                   DATVTERLRDAGLVILGKTNLDEFAMGSSTENSAYGPTRNPWDTDRVPGGSSGGSSAAV
FT                   AAFEAPLATGTDTGGSIRQPAAVCGLVGAKPTYGTSSRYGLIAFASSLDTPGPIARNVL
FT                   DAALLHEAFSGHDPRDSTSVNEPVPPVVEAARRADVSGMRIGVVKELSGEGYQPGVMQR
FT                   FTEAVELFESLGAKIVEVSCPSFTAALAAYYLIAPSECSSNLARFDAMRYGLRVGDDGT
FT                   RSADEVMALTRAQGFGPEVKRRIILGTYALSSGYYDAYYGSAQKVRTLIKRDFEAAFQQ
FT                   ADVLVSPTTPTTAFRLGERIDDPMAMYLADLCTIPTNLAGNAALSVPCGLAPEDNMPVG
FT                   LHIMAPTLADDRAYQAGAAVEAALRDKWGGDLLSQCAYAV"
     atgaccgagc tgctcaagct gagcgctgct gaactcggcg cggccatcgc ttcaggggag        60
     acctccgcgg tcgaagccac ccaggcctac ttggaccgga tcgcggaagt cgacggccag       120
     atccacgcgt tcctccacgt cgccgccgac aaagcgctgg aacaggcccg cgcggtggac       180
     gcccggcgcg ccgcagggga gaaactcggc ccgctggccg gggtgcccgt ggcgcacaag       240
     gacgtgttca ccaccaagga catgcctacc accgcggcgt cgaagatcct cgagggctgg       300
     cagtcgccct acgacgccac ggtcacggaa cgtctccggg acgccgggct cgtcattctc       360
     ggcaagacca acctggacga gttcgccatg gggtcctcga cggagaactc cgcctacggt       420
     cccacccgca acccgtggga caccgaccgg gtgcccggcg ggtcgtccgg aggctcctct       480
     gccgcagtag ccgctttcga agccccgctg gcgaccggaa ccgacaccgg cggctccatc       540
     cggcagcccg cggctgtgtg cggcctcgtc ggcgccaaac ccacctatgg cacgtcgtcg       600
     cgctacggtc tgatcgcttt cgcgtcctcg ctcgacacgc ccgggccgat cgcccgcaat       660
     gtcctggacg cggctctgct gcacgaggcg ttctccgggc acgacccgcg cgactctacg       720
     tcggtgaacg agccggtgcc cccggtggtg gaagcggccc gacgcgccga cgtttccgga       780
     atgcgcatcg gcgtggtcaa ggagctgtcc ggcgagggct accagccggg tgtgatgcag       840
     cgtttcaccg aggctgtgga gctcttcgag tcgctgggcg ccaagatcgt cgaagtgtcc       900
     tgcccgagct tcaccgccgc gctcgcggcg tactacctca tcgcgcccag cgagtgctcg       960
     tccaacctgg cccgcttcga cgccatgcgc tacggcctgc gggtcggcga cgacgggacg      1020
     cggagcgccg acgaggtgat ggcgctgacc cgcgcccaag ggttcggtcc cgaggtgaag      1080
     cgccgcatca tcctgggcac ctacgcgctg tcgagcggct actacgacgc ctactacggg      1140
     tcggcgcaga aggtgcgcac actcatcaaa cgggactttg aagccgcgtt ccagcaggct      1200
     gacgtgctgg tttcgccgac gacgccgact acggcgttcc ggctgggcga gcgcatcgac      1260
     gatccgatgg cgatgtacct ggccgacctg tgcacgatcc cgacgaacct ggcggggaac      1320
     gctgcgctgt cggtgccgtg cgggctcgct ccggaagaca acatgccggt gggcctgcac      1380
     atcatggcgc cgacgctggc cgacgaccgc gcctaccagg cgggtgcggc cgtggaggcg      1440
     gccctgcggg acaagtgggg cggcgacctg ctgtcgcagt gcgcctacgc ggtctaa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page