(data stored in ACNUC7421 zone)

EMBL: CP000088.PE607

CP000088.PE607       Location/Qualifiers
FT   CDS_pept        702629..704182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0609"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54647"
FT                   /db_xref="GOA:Q47SC0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54647.1"
FT                   /translation="MGSAVTSDHSAKGGATALMPYDEVLRGYEPVLGLETHVELGTRSK
FT                   MFCSCATTFGAEPNTQVCPVCLALPGALPVVNSAAVESAIRLGLALNCSIAEWCRFARK
FT                   NYFYPDMPKNYQISQYDEPLCYDGYLDVTVDTPEGPREFRIGIERVHMEEDTGKTSHVG
FT                   GADGRIHGAEYSTVDYNRAGIPLLEIVTKPIEDAGEWAPQVARAYVRELRDLIRALGIS
FT                   DVRMEEGSLRCDVNVSLKPRGSTEWGTRTETKNVNSLRSIERAVRHEIERQGGVLSAGG
FT                   RVVQETRHFQESTGTTVAGRSKEEAQDYRYFPDPDLVPVAPDREWVEQLRATLPELPSA
FT                   KRRRLKAEWNLTDKELQDLVNANAVDLVEQTVAAGAPPAEARKWWLNDLSRRATETGVE
FT                   LSELPITPAQVARVVELVAEGSLTNKLARQVVDGVLAGEGEPDEVVEARGLRVVSDDAA
FT                   LGAIVDQAIANNADAAEKVRNGKIAAVGALVGAVMRETKGQADAGRARQLILERLGVSG
FT                   "
     atgggtagcg cggtgacgag tgaccactcc gccaagggcg gtgctacggc gctgatgccc        60
     tacgacgagg tactgcgcgg gtacgagccg gtactgggat tggagaccca cgtcgagctg       120
     ggtacccgct cgaagatgtt ctgctcctgc gccactactt tcggcgccga accgaacacc       180
     caggtgtgcc cggtgtgcct ggcgctgccg ggtgcgctgc cggtggtcaa cagcgcggca       240
     gtggagagcg cgatccggct cggtcttgcg ctgaactgct ctatcgccga gtggtgccgg       300
     tttgcccgga agaactactt ctatccggac atgccgaaga actaccagat ctcgcagtac       360
     gacgagccgc tctgctacga cgggtacctc gacgtcacgg tggacacccc ggaagggccg       420
     cgcgagttcc ggatcggtat cgagcgcgtc cacatggagg aggacaccgg taagacgtcg       480
     cacgtgggcg gggctgacgg ccggatccac ggcgccgagt actccaccgt cgactacaac       540
     cgcgcgggga ttccgctgct ggagatcgtc accaagccga tcgaggacgc cggggagtgg       600
     gctccccagg tggcccgcgc ctatgtacgg gagctgcgtg acctgatccg cgccctgggg       660
     atctccgacg tgcgcatgga ggagggttcg ctccgctgcg acgtcaacgt ttcgctgaag       720
     ccgcgcggga gcacggagtg gggcacccgg actgagacga agaacgtcaa ctcgctgcgt       780
     tcgatcgagc gggcggtccg ccacgagatc gaacggcagg gcggggtcct gtccgcgggc       840
     ggccgcgtcg tgcaggagac ccggcacttc caggagagca cgggaaccac tgtggcgggg       900
     cgcagcaagg aggaggcgca ggactaccgc tacttccccg accctgacct ggtgccggtc       960
     gcgcccgacc gcgaatgggt ggagcagctc cgcgccaccc tgccggaact gccttccgcg      1020
     aagcggcgcc ggctcaaggc cgaatggaac ctgaccgaca aggagctgca ggacctcgtc      1080
     aatgcgaacg cggtcgacct ggtcgagcag actgttgccg cgggcgctcc cccggctgag      1140
     gcgcgcaagt ggtggttgaa cgacctgtcg cggcgggcca cggagaccgg tgtggagctg      1200
     agcgagctgc cgatcacccc ggcccaggtc gcccgggtcg tggagctggt tgccgagggg      1260
     tcgctcacca acaagctggc ccggcaggtg gtcgacgggg tgctcgcagg agaaggcgag      1320
     ccggacgagg tggtggaagc ccgcgggctg cgggtggtca gcgacgacgc tgccctgggc      1380
     gcgatcgtcg accaggcgat cgcgaacaac gcggacgccg ccgagaaggt ccgcaacggc      1440
     aagatcgccg cggtgggcgc cctggtcggt gcggtcatgc gggagaccaa gggccaggcg      1500
     gacgcgggac gggcacggca gctcatcctg gagcggctgg gggtctcggg ctga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page