(data stored in ACNUC7421 zone)

EMBL: CP000088.PE609

CP000088.PE609       Location/Qualifiers
FT   CDS_pept        707643..709412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0611"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54649"
FT                   /db_xref="GOA:Q47SB8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54649.1"
FT                   /translation="MTEQMTGAQSLIRALEHVGVDVVFGIPGGAILPAYDPLYDSTKVR
FT                   HILMRHEQGAGHAAEGYAYATGRPGVCIATSGPGATNLVTPLADAYMDSVPVVAITGQV
FT                   ASPAIGTDAFQEADICGITMPITKHNFLVRDPSKIASTIAEAFHIASTGRPGPVLVDIA
FT                   KDALQAQTRFEWPQRPELPGYRPVTKPHGKQVREAARLIAEAKRPVLYVGGGVFKSGAS
FT                   KELRVLAELTGIPVVTTLMALGTFPSSHPQNLGMPGMHGTVAAVGALQRADLIVALGAR
FT                   FDDRVTGKLSSFAPHATIVHADIDPAEISKNRYADVPIVGDCREVIADLIVAVRADQAA
FT                   GRQGDYTAWWEQLNRMRETYPLGYTEPEDGSLAPQYVIKRIGQIVGPDATYVAGVGQHQ
FT                   MWAAQFIDHQRPGSFVNSGGAGTMGFAIPAALGAKVGDPDRVIWAIDGDGCFQMTNQEL
FT                   ATCAIEGIPIKVAVINNGNLGMVRQWQTLFYDGRYSNTNLHTAPTPEDGKVRIPDFVRL
FT                   AEAYGCVGLRCDRAEDVDATIEKAMAINDVPVVIDFTVHHDAMVWPMVPAGVSNDDIQY
FT                   ARDMAPEWDDEEE"
     atgaccgagc agatgaccgg agcccaatcg ctcatcaggg cgctggagca tgtcggcgtc        60
     gatgtcgtgt tcggaatccc tgggggggcg atcctccccg cctacgaccc gctgtacgac       120
     tccaccaagg tgcgccacat cctcatgcgc cacgagcagg gggccgggca cgcagccgaa       180
     ggatatgcct acgccacggg acgaccaggg gtgtgtatcg ccaccagtgg ccccggcgcg       240
     accaacctgg tgaccccgct tgcagacgcc tacatggact cggtccccgt ggtcgcgatc       300
     accgggcagg tggccagccc ggcgatcggc accgacgcgt tccaggaagc cgacatctgc       360
     ggcatcacca tgccgatcac caagcacaac ttcctggtcc gggacccctc caagatcgcc       420
     agcaccatcg ccgaggcctt ccacatcgcc tccaccggcc gtcctggccc ggtcctcgtg       480
     gacatcgcca aggacgcgct gcaagcacag acccgcttcg aatggccgca acggcccgaa       540
     ctgcccggct accgccccgt caccaaaccg cacggtaagc aggtgcggga ggcggcacgg       600
     ctgatcgccg aagccaaacg ccccgtgctc tacgtcggcg gcggagtgtt caaatcgggt       660
     gcgtccaaag aactgcgtgt actggctgaa ctgacaggga ttccggtcgt caccaccctc       720
     atggcactgg gcaccttccc cagcagccat ccccagaacc tcggcatgcc gggaatgcac       780
     ggcaccgtcg ccgcggtcgg cgccctgcag cgcgccgacc tgatcgtggc gctgggcgcc       840
     cggttcgatg accgggtcac cggcaagctc agctcgttcg ccccccacgc caccatcgtg       900
     cacgccgaca tcgacccggc cgagatctcc aagaaccggt acgccgacgt gccgatcgtg       960
     ggcgactgcc gggaggtcat cgcggatctg atcgtggcgg tccgtgccga ccaagccgcc      1020
     ggacgccagg gcgactacac cgcgtggtgg gagcagctca accgaatgcg cgagacctac      1080
     ccgctgggct acaccgagcc ggaggacggt tcgctcgccc cccagtacgt gatcaagcgc      1140
     atcggccaga tcgtcggccc cgacgccacc tacgtcgccg gagtgggcca gcaccagatg      1200
     tgggctgccc agttcatcga ccaccagcgt cccggctcct tcgtcaactc gggcggcgcc      1260
     ggaacgatgg gcttcgccat ccccgcggcc ctcggcgcca aggtcggcga ccccgatcgg      1320
     gtcatctggg cgatcgacgg cgacggctgc ttccagatga ccaaccagga gctggccacc      1380
     tgcgcgatcg aaggcatccc gatcaaggtt gcggtgatca acaacggcaa cctcggtatg      1440
     gtccgccagt ggcagaccct gttctacgac ggccgctact ccaacaccaa cctgcacacc      1500
     gcgcccaccc ccgaagacgg gaaggtgcgc attccggact tcgtccgcct cgcagaggcg      1560
     tacggttgtg tcgggctgcg ttgcgaccgc gcagaagacg tggacgccac catcgagaaa      1620
     gccatggcca tcaacgacgt gcccgtggtg atcgatttca cggtccacca cgacgcaatg      1680
     gtctggccga tggtcccggc tggagtcagc aacgacgaca tccagtacgc gcgcgacatg      1740
     gcgcctgaat gggacgacga ggaagaatag                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page