(data stored in ACNUC7421 zone)

EMBL: CP000088.PE61

CP000088.PE61        Location/Qualifiers
FT   CDS_pept        complement(75451..79521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54101"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54101.1"
FT                   /translation="MTKRTSPTGSKRSGLQPEQHWQQEGDNLWWIPAGTPVVVNFITIP
FT                   DGMVYVGQTPSTKEPPPELSQLDPSLPVGWAPDFHPSLPRGASMLPYRLLLPSARTAYL
FT                   RWLASGRKRRGLSISFVYLFFTGLESRILRNLKEHKRASDLSAIREETERLLAVYGADA
FT                   RLEKQAAHFLKLLTYLEDTPEQDWQLSWTQDPSPGEETYRPSISQRQPVHYRKPHKPQT
FT                   VPSKPALFEQQVQPEKPAETTTAPTPTAPNTDTGKPIPTPAAQPAEKPQSEAVQPRSAP
FT                   QQSDFLDRKRLAAVQDEVRHTDAFLADLYENEEDEEHTEETAPVLAPPAASTRTETDTD
FT                   TAVLSRLEHRLHAFLATLITKQEWARVEVSSLARHHGLMIDGALAEINEYALDLVDMEL
FT                   VDEQEDTIEVDPEVVEVLRKQGALPASVETPPTKAEQQPAASSSAPPPAVLPEPPAARG
FT                   QEGFWVRIGETVSVQGRKITTGLVYVGTPVDDRQAALINPGLPAESAPGTPASNHHGKG
FT                   YHQLPPDARGRYLDWLAAGRIGVVSEDTPLFLFLYGLEQRVLCDILPGSAPTSELATIH
FT                   AELDRLIDTYRIMRRFRQRAYTLRALVRYLAQGNLHSPGKPPSPKDPYDTLPDELRYGL
FT                   GVLKAHNKQIPADWALSWAVHHEQVRPPMALRTDEAFHEAFRRRFTEEFPGGMPVPFNE
FT                   GKEFTWVYTPANPDLDTIRVPVPEIYDISNLALPLSHLGRIVRAAQADVEKTKKEEARP
FT                   AQPFATPLPHPEAELSQTTQKIRWSSWKAPGTTVRISKYTIPDGMVYTGYAPREADDDI
FT                   QRSSAIDLSLEIDSSVVSPHGRAPRRPVAGYPDLTPQERARYLSWLANRDSGASVPIVF
FT                   GRLFRNGLERRIIEMIRSTKEKIRIPPRLREELKRLIEEFAASPEFTEQTRRLLILADI
FT                   ASGEKLAAPSSPPRYSPATQQIPQEFRLGLGLLARDNLSLPPEWALEWVLYHLRPENPE
FT                   EYRKNFSSLNLPLPYKGLILPYQGDQIVPATAPQFEYVYRASCPGLGEVRLPVPGVRDV
FT                   ADIAPPQDLVNRVQKIYAQAVERNRLAGNTATPSSTLAAGNLATGNTTLHSSPANRATA
FT                   APAAPKPPAVTPPPVPAPAAASQQTIRDFAELALHLASLAGPLTVEHRLLITRAAETIA
FT                   DLFEKDWRELRLHERETAATEPPLNLCSRLAQLPLREREKLGDLLLDVAEVGGKTTENQ
FT                   TVFLLSVHRILGLEAILRLRLSYRGIAPPPDNPHSGNPLTPASPDTPLTPKKLPKITPL
FT                   SQRHIALLTDLATRDHWNLADTTRLAHWYGIDVYEAIDAINEVALHRTGTVVLSENDDH
FT                   ITVHKVIFEEMTQ"
     ttgaccaaga gaacgtcgcc tacgggatcg aaaagaagcg gtctccagcc ggaacagcac        60
     tggcagcaag aaggcgacaa tctctggtgg atccctgctg gcaccccggt cgtcgtcaac       120
     ttcatcacca tccccgacgg gatggtgtac gtcgggcaaa ccccttccac caaagaaccg       180
     ccccccgaac tctcacagct cgacccctcg ctgcccgtcg gttgggctcc cgacttccac       240
     ccctccctgc cgcggggtgc ctccatgctc ccctaccgtc tcctcctccc ctcagccaga       300
     accgcctacc tgcgctggct agccagcggc cgaaaaagac gcggcctctc catcagcttc       360
     gtctacctct tcttcaccgg actagaaagc cggatcctgc ggaatctgaa agagcacaaa       420
     cgagcaagcg acctctcagc catccgcgaa gaaaccgagc ggctgctagc cgtctacggc       480
     gctgacgcca ggttagaaaa gcaggcagct cacttcctca agctgctcac ctacctcgag       540
     gacacccctg aacaggactg gcagcttagc tggacgcaag acccctcgcc cggagaggag       600
     acctaccgtc catccatctc ccagcgccaa cccgtccact accggaagcc gcacaagcct       660
     caaaccgtcc ccagcaaacc cgccctcttc gaacaacagg tacaaccaga aaaacccgcg       720
     gaaacaacaa cagccccgac ccctaccgcc cccaacaccg acactggaaa acccatcccg       780
     actccggccg cacaaccagc agaaaaacca cagagcgaag cggtccaacc gcgctctgct       840
     ccccaacaaa gcgacttcct cgaccgcaag cgcctcgccg ccgtccaaga cgaggtgcgt       900
     cacacagacg cattcctcgc cgacctgtac gaaaacgaag aagacgagga gcacacggaa       960
     gaaacagccc ccgttctagc tcctcccgcc gcgtccacca gaaccgagac ggacacagac      1020
     accgcagtcc tctcccggct ggaacaccgg ctccacgctt tcctcgccac cctgatcacc      1080
     aagcaggaat gggctcgggt cgaagtctcc tcgctcgccc gacaccacgg cctcatgatc      1140
     gacggtgcgc tagccgagat caacgaatac gcactcgacc tcgtcgacat ggagcttgtc      1200
     gacgagcaag aagacaccat cgaagtcgac cctgaagtgg tagaggtgct ccggaaacaa      1260
     ggagccctgc ccgcctccgt cgagacgcct ccaaccaaag cagagcagca gcctgccgcg      1320
     tccagcagcg caccgcctcc ggctgtcctg ccagagccgc cagccgcccg aggtcaggaa      1380
     ggcttctggg tcaggatcgg ggaaaccgtc tccgtccaag gacggaaaat cacaaccgga      1440
     ctggtctatg tcggaacccc ggtcgacgat cggcaagccg cgctcatcaa ccccggcctc      1500
     ccggctgaga gcgctccagg cacccccgcc tccaaccatc acggcaaggg ctaccaccag      1560
     cttccccctg acgcccgagg ccgctactta gactggctcg ccgcgggacg catcggagtg      1620
     gtgtccgaag acaccccgct cttcctcttc ctctacgggc tagagcagcg ggtgctgtgc      1680
     gacatcctcc caggcagtgc acccaccagc gaactggcaa ccatccacgc ggaactggac      1740
     cgcctcatcg acacgtaccg catcatgcgg cgcttccggc agcgcgcata cacactacgc      1800
     gcgctcgtca gatacctcgc tcaaggaaac ctccacagcc ccggcaaacc accgtcgccc      1860
     aaagacccct acgacacgct gcccgacgaa ctccgctacg ggctgggtgt gttgaaagca      1920
     cacaacaagc agatccccgc cgattgggcg ctgtcctggg ctgtccacca cgagcaggta      1980
     cgcccgccca tggctctgcg caccgacgag gctttccacg aagcgttccg gcgacgcttc      2040
     accgaagaat tcccaggagg aatgcctgtt cccttcaacg aaggaaaaga attcacctgg      2100
     gtctacacac ccgccaaccc cgatcttgac acgattcgag tccccgtccc cgaaatctat      2160
     gacatcagca acctagccct cccgctgagc catttggggc gtattgttcg cgcagcacaa      2220
     gccgatgtag agaagacaaa gaaagaagaa gcccgtcctg cgcaaccctt cgctacaccc      2280
     cttccccacc cagaagccga actctctcaa acaacccaaa aaatccgctg gtcttcctgg      2340
     aaagcacccg gaacaactgt ccgcatcagc aaatacacta ttcccgatgg aatggtgtat      2400
     acaggctatg ccccgcgaga ggcagacgac gacatccagc gctcttcagc catcgacctc      2460
     tccttggaaa tcgacagctc tgttgtcagc ccgcacggca gggctccccg ccgtccagta      2520
     gccggatacc ccgacctcac cccgcaggag cgggcccgat acctgtcatg gctggcaaac      2580
     cgggacagtg gagcatcagt tccgatcgtc ttcggaagac tattccgcaa tgggctagag      2640
     cgccggatca tcgaaatgat ccggtccacg aaagagaaaa ttcgcatccc tccgcggttg      2700
     cgcgaagaac tgaaacgact catcgaagaa ttcgcggcga gccccgaatt cactgagcaa      2760
     acacgccgcc tactcatcct tgccgacatc gccagcggag aaaaactcgc ggcccctagc      2820
     tctccgcccc gctactctcc agcaacccag cagattccac aagaattccg actcgggcta      2880
     ggactgctgg ctcgagacaa cctctccctg cctcccgagt gggcactgga atgggttctc      2940
     taccatctac gtccagaaaa ccctgaggaa taccggaaaa acttctcctc cctcaacttg      3000
     ccgctcccct acaagggtct catcctcccc taccaaggcg atcagatcgt tccggcaacc      3060
     gccccgcaat tcgaatacgt ctaccgggct tcctgccccg gcctgggaga agtccggctg      3120
     ccggtacctg gggtgcgcga cgtggccgac atcgccccgc cgcaggacct ggtcaaccgg      3180
     gtacagaaga tctacgcgca agccgtggaa cggaaccggc ttgccgggaa cacggcaacc      3240
     ccaagctcaa ccctcgccgc gggaaacctc gccacgggga atacgacgct gcactcttcc      3300
     cccgccaacc gggcaacagc agctcccgcc gcgccgaaac ccccagcagt caccccgcca      3360
     ccagtccccg ctccagcggc agcctcacag caaaccatcc gggacttcgc tgagcttgct      3420
     cttcacctgg catccctggc aggaccgctg accgtcgaac accggctcct catcacgaga      3480
     gcggccgaaa ccatagccga cctgttcgag aaagactggc gggagctgcg cctgcacgaa      3540
     cgggagacag ccgccacgga acccccgctc aacctgtgct cccgcctcgc ccaactcccg      3600
     ctacgcgagc gggaaaaact cggcgacctg ctgctcgacg tcgccgaagt gggcggaaaa      3660
     accaccgaga accagactgt tttcctgctc agcgtccacc gcatcctcgg cttggaagca      3720
     atcctccggc tgagactgag ctaccggggg atcgctcccc cgcccgacaa cccccactcc      3780
     gggaacccgc tcaccccggc ctcccccgac acaccgctca ccccaaagaa actcccgaaa      3840
     atcacgccgc tcagccagcg ccacatcgcg ctgctcaccg accttgcaac ccgcgaccac      3900
     tggaaccttg ccgacaccac tcggctagcc cactggtacg gcatcgacgt ctacgaagcg      3960
     atcgacgcaa tcaacgaagt agcgctgcac cggaccggca ccgttgtcct cagcgaaaac      4020
     gacgaccaca tcaccgtgca caaggtgatc ttcgaggaga tgacccagtg a               4071
//

If you have problems or comments...

PBIL Back to PBIL home page