(data stored in ACNUC7421 zone)

EMBL: CP000088.PE616

CP000088.PE616       Location/Qualifiers
FT   CDS_pept        complement(717936..718709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0618"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54656"
FT                   /db_xref="GOA:Q47SB1"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54656.1"
FT                   /translation="MTAQKAGRPRRTGRHRRRQLPVGTIAGLIVALSGVGMVSANVLPW
FT                   EPSDPASVVPATSQGSSSPMTPEPSPSPVPPLLRSVVEEVPSASGELRVVEGDGEVVGE
FT                   GTLLRYLVEVEEGLPGDPADFAAAVEHVLSDPRSWTHDGTLAFQRVDEEPVDFRVTLAS
FT                   PETVDQQCAPLQTNGYVSCFSGERAMINQNRWVSGVPHFDGDLETYRAYVINHEVGHAL
FT                   GYGHVDCPAPGEPAPVMQQQTFGLQGCEKNGWVSP"
     atgactgcgc agaaggcagg acgaccacgc cgtaccggtc gacatcgacg gcgtcaactg        60
     ccagtgggga ctatcgcggg gctgattgtc gcgctgtcag gcgtggggat ggtctcggcc       120
     aacgtgctcc cgtgggaacc gtcggacccg gcatccgtgg tccccgccac ctcgcagggc       180
     agcagttctc ccatgacgcc ggagccctcg ccgtccccgg tacccccact gctgcgctcc       240
     gtggtcgaag aggtgcccag cgcaagcgga gaactgcggg tcgtcgaagg tgacggggag       300
     gtcgtcggcg aaggcacgct cctgcgctac ctggtggagg tcgaagaagg gcttcccgga       360
     gaccccgccg acttcgctgc agcggtcgag cacgtgctca gcgacccccg aagctggacc       420
     cacgacggca cgctggcctt ccagcgggtc gacgaagaac cagtggactt ccgggtcacc       480
     ctcgcctccc ccgagaccgt agaccagcag tgcgcgccac tgcagaccaa cggctacgtc       540
     tcctgcttct ccggggaacg cgcgatgatc aaccagaacc gctgggtgtc cggcgtgccg       600
     cacttcgacg gcgacctgga gacctaccgc gcctacgtca tcaaccacga agtcggccac       660
     gcgctcggct acggccacgt ggactgccct gcccccgggg aacccgcgcc agtcatgcag       720
     cagcagacgt tcgggctgca ggggtgtgag aagaacgggt gggtgagccc ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page