(data stored in ACNUC7421 zone)

EMBL: CP000088.PE617

CP000088.PE617       Location/Qualifiers
FT   CDS_pept        complement(718836..719174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54657"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54657.1"
FT                   /translation="MASVVKFNVLTVPPGAGATLEERFAKRAGLVENQPGFEEFQLLRP
FT                   VDGTDKYIVYTRWRSEEDYQNWLNSEAFQRGHAQASEDSRRSSQGGPAASASELWSFEV
FT                   VQHVQAQD"
     atggccagtg tggtgaaatt caatgtgctg acggttcctc ccggtgccgg cgccaccctg        60
     gaggagcgtt tcgccaagcg cgcaggcctc gtggagaacc agcccggctt tgaggagttc       120
     caactgctgc gtcccgtcga cgggaccgac aagtacatcg tctacacgcg ctggcgctcc       180
     gaagaggact accagaactg gctgaacagc gaggccttcc agcgcggaca cgcccaggcc       240
     tctgaagact cccgccgcag cagccagggc ggcccggccg cgtccgcgag tgaactctgg       300
     tccttcgaag tcgtccagca cgtccaggcc caggactga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page