(data stored in ACNUC7421 zone)

EMBL: CP000088.PE72

CP000088.PE72        Location/Qualifiers
FT   CDS_pept        94397..95581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0074"
FT                   /product="ABC branched-chain amino acid transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54112"
FT                   /db_xref="GOA:Q47TV2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54112.1"
FT                   /translation="MRYPPYAPFAAALCAGALVLTACGSPESAATGDADGPIKIGLVYS
FT                   MSGPLATYGEQYYQGFEAGLEYATGGTMEVDGRPIEVTTRDDAGDPTKAVSAARELIGE
FT                   GYDIIAGSTASGVAVQVAPLAEQNKVLFISGPAATDAITGINDYTFRSGRQTYQDILAA
FT                   GSFMDDPEGKNVIVFAQQNAFGQDNVDAVTTVLEAQGATVDSVLAPPDTTDLTPFAEQV
FT                   RQADPDLLFVAWAGETASAMWKALNQQGVLDATEVVTGLDIKASYPVFGEAEGKISFLS
FT                   HYFDGAAQTEAEQMMREFVEDNGGEVDLFTPDGFTAAQMIVHAISEGDTTEERIKALEG
FT                   WTFEGVKGTLTIRAEDHALLQPMYQVRLVGSGADAVPELIAEIPAADVEPPVAE"
     atgcgttatc ccccttacgc acctttcgca gccgcgctct gcgccggtgc tctcgtcctc        60
     accgcctgcg gcagcccgga gagcgccgcc acaggcgacg ctgacggccc catcaaaatc       120
     ggcctcgtct actccatgag cgggccgctc gccacctacg gcgagcagta ctaccagggc       180
     ttcgaagccg gactcgaata cgccaccggc ggcaccatgg aagtcgacgg ccggcccatc       240
     gaagtcacca cccgggatga cgctggcgac cccaccaagg cggtgtccgc ggcccgggaa       300
     ctcatcggcg aaggctacga catcatcgcc gggtccaccg cgtccggcgt ggccgtccaa       360
     gtcgccccgc tcgccgaaca gaacaaggtg ctgttcatct ctggaccggc cgccaccgac       420
     gccatcaccg gcatcaacga ctacacgttc cgttccggcc gccagaccta ccaggacatt       480
     ctcgccgcgg gttctttcat ggacgacccc gaaggcaaga acgtcatcgt cttcgcccag       540
     cagaacgcgt tcggccagga caacgtggac gcggtcacca ccgtcctcga agcccagggc       600
     gccaccgtgg acagtgtcct cgccccgcct gacaccaccg acctgacccc gttcgcggaa       660
     caggtccgcc aagccgaccc tgacctgctg ttcgtggcgt gggcggggga gaccgcctcc       720
     gccatgtgga aggccctcaa ccagcagggg gtcctcgacg ccaccgaggt cgtcaccgga       780
     ctggacatca aagcgtccta cccggtgttc ggcgaagctg aaggcaagat ctccttcctc       840
     tcccactact tcgacggggc cgcgcagacc gaagccgagc agatgatgcg cgaattcgtc       900
     gaagacaacg gcggtgaagt ggacctgttc acccccgacg ggttcaccgc cgcgcagatg       960
     atcgtgcacg ccatctctga aggcgacacc accgaggagc ggatcaaagc cctggaaggc      1020
     tggaccttcg aaggcgtgaa aggcaccctg accatccggg cggaagacca cgcgctcctc      1080
     cagcccatgt accaggtgcg gttggtcggc agcggcgcag acgctgtccc cgaactgatc      1140
     gcggaaatcc ctgccgccga cgtggaaccc ccagtcgcgg agtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page