(data stored in ACNUC7421 zone)

EMBL: CP000088.PE75

CP000088.PE75        Location/Qualifiers
FT   CDS_pept        97096..97992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0077"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54115"
FT                   /db_xref="GOA:Q47TU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54115.1"
FT                   /translation="MSTVVLLVVTGLGLGALYFLIASGLSLIFGLMDVLNFAHGAFLTI
FT                   GAYATWWASVYLPGAGGDGVGFLVAVAFGVAAGTLAATLVELGVIRPLYGRHREQILVT
FT                   VGLSLAVPALVQAIWGADPLPFPRPELVSGTVTLLGAAIPTDRFLLIAVAALVLAGLLL
FT                   FGTRTRYGLIVRAGVEDRAMVTALGIDVRKSFTLVFAIGGAAAALAGALGGLYFGVITP
FT                   FQGTSLLVFAFIVVVIGGTTSTVGCAVASVAVGMVQQFANYYTVAGLGDIAVVIVLAAV
FT                   LLTRQGGLAKATAGRVA"
     atgagtaccg ttgtcttgct cgtcgtgacc gggctcgggc tcggcgcgct ctacttcctc        60
     atcgcttcag gcctgtccct catcttcggc ctgatggatg tgctgaactt cgcgcacggc       120
     gcgtttttga ccatcggcgc ctacgccacg tggtgggcca gcgtctatct gcctggcgca       180
     ggcggggacg gggtcggttt ccttgtcgct gtagcgttcg gggttgctgc gggcacgctc       240
     gctgccaccc tcgtcgaact cggggtgatc cgccccttgt acgggcggca ccgggagcag       300
     atcctcgtca ctgtcggact cagcttggcg gtccccgctc tcgtgcaagc gatctggggc       360
     gcggacccgc tgccgttccc ccgcccggag ctcgtctccg gcacggtgac tctgcttggc       420
     gcggccattc ccaccgaccg gttcctgctg atcgcggttg ctgccctggt cctcgccggg       480
     ctgctgctgt tcggaacccg cacccgctac ggcctgatcg tgcgcgccgg agtggaggac       540
     cgggccatgg tcaccgcgct tggtatcgac gtgcgcaagt ccttcacctt ggtgttcgcg       600
     atcggcgggg ccgcggccgc gctcgcgggc gcgctcggcg gcctctactt cggggtgatc       660
     accccgttcc aaggcacgtc cctgctggtc ttcgcgttca tcgtggtcgt gatcggcggt       720
     accacgtcca cggtgggctg cgcggtcgcg tcggtcgcgg tcggcatggt ccagcagttc       780
     gccaactact acaccgtcgc cgggctcggc gacatcgccg tggtgatcgt gctcgccgca       840
     gtgctgttga cgcggcaggg cgggctcgcc aaagcaaccg ccgggagggt ggcatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page