(data stored in ACNUC7421 zone)

EMBL: CP000088.PE78

CP000088.PE78        Location/Qualifiers
FT   CDS_pept        complement(100065..102011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0080"
FT                   /product="GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54118"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54118.1"
FT                   /translation="MERELNNTPVPPEDDPWAVDAQSAFLELLLRDAPAVEYERPLLEA
FT                   RARGDTPETLARLERAKLLALRVRSVLRDLQRRESELTALFETANDLTGMRSLDQMLRA
FT                   IVDRARHLLNTDVAYLTLSDPERGDTYMRVTSGSVSARFQQLRLGHGEGLGGLVAQTAL
FT                   PYVTANYFADTRFQHTEHIDAGVREEGLVAILGVPLQLNGRVIGVLFAANRRERPFSHA
FT                   EVALLSSLATHAAIAIDNANLIDDTRRALAELNTVNQRLQEHTESVERAAAAHDRLTDL
FT                   VLRGGGIEEVAAAVGDVLGGQVCIHDLNTAATPPPCCEDPAVAEAVQTALHSGRTARAG
FT                   DAWVAAAAAGSELLGMLVLRGIEPDITGQRILERAAVVTALLLLIRRSATEAEHRVRGD
FT                   LLDELLDTPDRDPESLRQRAARLGADLTVPHVVAVAESPGADVGRLRLAAMHIAETTGG
FT                   LAGIRGGRVVLVLPGTDPTTVGRRIGADLGVAVNGPVTVGVAGPVEALPGFRSSFTEAL
FT                   RCLQTLQALGRTGEVAAPTDLGFLGLLLGDDRDVDGFVTATLGPLLDYDARRKTALVDT
FT                   LRAYFAAGGNLSRAKDALHVHVNTVSQRLERISQLIGDDWQEPSRALEIQLALRLHGLL
FT                   DRGVDLGGNRGRG"
     atggagcgcg agctgaacaa caccccggtt ccccccgaag acgacccgtg ggcggtagac        60
     gcccagtcgg ccttcctgga acttttgctg cgcgacgctc ccgcggtcga atacgaacgg       120
     ccgctgctgg aagcccgtgc ccgcggggac accccggaaa ccctggcccg gttggaacgc       180
     gccaaactcc tggcgctacg ggtccgctcc gtcctccgcg acctgcagcg ccgcgaatcc       240
     gaactcacgg ccctgttcga aaccgctaac gacctgaccg ggatgcgcag cctcgaccag       300
     atgctgcgcg ccatcgtgga ccgggcccgc cacctcctca acaccgacgt cgcctatctg       360
     acactcagcg acccggaacg cggggacacc tacatgcggg tgacgtccgg ttccgtctca       420
     gcccgcttcc agcagctacg cctcggccac ggggaaggtc tgggcggcct ggtcgcccag       480
     accgccctcc cctatgtcac cgccaactac ttcgcggaca cccggttcca gcacaccgag       540
     cacatcgacg cgggggtgcg cgaagaaggc ctggtcgcga tcctcggcgt gccgctccaa       600
     ctcaacggcc gtgtcatcgg cgtcctgttc gccgccaacc ggcgggaacg gccgttctcc       660
     cacgcggaag tagccctgtt gagctcgctg gccacgcacg cggcgatcgc tatcgacaac       720
     gccaacctca tcgacgacac ccggcgggcg ctcgccgaac tcaacaccgt caaccagcgg       780
     ctccaagaac acaccgaatc cgtggaacgc gccgcggcag cccacgaccg gctcaccgac       840
     ctcgtgctgc gcggcggcgg gatcgaagaa gtcgcggccg cagtcggcga cgtcctcggc       900
     ggccaagtgt gcatccacga cctcaacacg gccgccactc ccccgccctg ctgcgaggac       960
     cctgccgttg ccgaagccgt gcagaccgcg ctgcacagcg gccgcaccgc ccgcgccggg      1020
     gatgcgtggg tggcagcggc cgcagccggc agtgaactgc tcggcatgct cgtcctgcgc      1080
     ggcatcgaac ccgacatcac cggccagcgc atcctggaac gcgccgccgt cgtcaccgcg      1140
     ctgctgctgc tcatccgccg ttccgcaacc gaagcggagc accgggtccg cggcgacctg      1200
     ctcgacgaac tcttggacac cccggaccgg gaccccgagt cgctgcggca gcgcgcggcc      1260
     cgcctcggcg cggacctcac cgtcccccac gtggttgcgg tcgcggaatc ccccggtgct      1320
     gatgtggggc ggctgcgcct cgccgccatg cacatcgctg aaaccacggg cgggctcgcc      1380
     gggatccgcg gcggccgggt cgtgctcgtc ctgcccggca ccgaccccac cacggtgggc      1440
     cgccgtatcg gcgctgacct gggggtcgcg gtcaacggtc cggtgaccgt gggggtggcg      1500
     gggccggtcg aagccctgcc cggattccgg tcctcgttca ccgaggcgct gcgctgcctg      1560
     caaaccctgc aggccctggg tcgcaccggg gaagtcgccg cccccaccga cctagggttc      1620
     ctcgggctgc tgctcggtga cgaccgggac gtcgacgggt tcgtcaccgc caccctgggc      1680
     ccgctgctgg actacgacgc ccgccggaag accgcgctcg tggacacgct gcgcgcctat      1740
     ttcgcggcgg gcggcaacct gtcgcgcgcc aaagacgcgc tgcacgtcca cgtcaacacg      1800
     gtctcccagc ggttggagcg gatctcccag ctcatcggcg acgactggca ggagcccagc      1860
     cgggccttgg agatccagct agcgctccgc ctccatggtc tgctggaccg cggtgtggat      1920
     ttgggcggca accgtggccg cggttga                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page