(data stored in ACNUC7421 zone)

EMBL: CP000088.PE83

CP000088.PE83        Location/Qualifiers
FT   CDS_pept        107759..108214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54123"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54123.1"
FT                   /translation="MVISEADFAKSSIMAAMPLARILGVEFVELAEERAVMRLPDNPDH
FT                   YDHTQNQHAGALIVLAETTSGAAVFNALGDRLKLALPVSLDARVDHRQPFSGPVVAEAV
FT                   LGEEWRTALTELEAGGQPEFPVDVALRAENGSTTGTATITWMLRPHP"
     atggtcatca gtgaggctga tttcgctaag tcgtccatca tggcggccat gccgctcgcc        60
     cgcatcctcg gcgtggagtt cgtggagttg gcagaggagc gggcggtgat gcggctccct       120
     gacaaccctg accattacga ccacactcaa aaccagcacg ctggagcgct gatcgtcctc       180
     gcagagacca cgtcgggggc agccgtgttc aacgcccttg gcgaccggct caaactcgcg       240
     ctccccgtgt ccttggacgc ccgcgtcgac caccgccagc cgttctccgg ccccgtggtc       300
     gctgaagccg tgctgggaga ggagtggcgc acagccctca cagaactgga agccgggggc       360
     caacccgaat tccccgtgga cgtggcgctg cgcgccgaga acggctccac caccggcacg       420
     gccacgatca cgtggatgct gcggccccac ccctaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page