(data stored in ACNUC7421 zone)

EMBL: CP000088.PE86

CP000088.PE86        Location/Qualifiers
FT   CDS_pept        complement(110298..110726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54126"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54126.1"
FT                   /translation="MRLVRVLLPLVTALPLFVARSWPFANRRETSAASSPAAEESPEVR
FT                   EPRPQPAVPLPAATLTYEQATDFVRVARRHAPLWALGYDPTQVVMFTARHRLLPDLVVG
FT                   ASDLEALDFTLIEFSPPDYARAYLSRVEKACASAEEDT"
     atgcgacttg ttcgcgtctt gcttccgctg gtcacagcgt taccgctgtt cgtggcccgg        60
     tcctggcctt ttgccaaccg ccgagaaacc tcagccgcct cttcccccgc cgctgaagag       120
     tcaccagaag tccgggaacc gcgcccccag cctgctgtgc cgttgcccgc ggcaaccctg       180
     acctacgaac aggcaacgga tttcgtccgt gttgcgcggc ggcatgctcc gctgtgggcg       240
     ctaggttatg acccgaccca ggtcgtgatg ttcactgccc gccaccggct cctgcctgac       300
     cttgtcgtgg gggccagcga cctggaagcc ctggacttta cgctgatcga gttcagcccg       360
     cctgactatg cccgcgccta tctctcccgc gtcgaaaagg cctgcgcctc ggctgaggag       420
     gacacgtaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page