(data stored in ACNUC7421 zone)

EMBL: CP000088.PE87

CP000088.PE87        Location/Qualifiers
FT   CDS_pept        110867..111697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54127"
FT                   /db_xref="GOA:Q47TT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54127.1"
FT                   /translation="MSGSLRGVLGSDQQIRCDTRSTPDVAISPTLRRRHLSSLLREARE
FT                   KRGLTAKWVAEKAKERSGRERGWSESKLNRLESGVWKRVRAEDITVLLDIYGITAPDER
FT                   ATYLTLVREAMQKGWWASYSDVLGTGEFVGLEAEASRIRTFESAAIPGLLQTEDYARAL
FT                   MRDSEQIGSSASLDRRVQARMLRQQILNQSSPPDFHTVIDESVLLRITPELAGQLDHLW
FT                   EASHRPHTDIRILPLSRGPHAAMTGQFVILDFPLPNQPVVYLEALAEEILPGQT"
     atgtctggtt ctctgagggg cgtcttagga tctgatcagc agattcgctg tgacacgagg        60
     agcacaccgg acgtggctat cagtcccact cttcgccgcc gacacctctc ctcgctgctg       120
     cgtgaagcac gcgagaagcg agggcttacg gccaagtggg tggctgagaa agccaaggag       180
     cggtccgggc gggagcgcgg ctggtccgag tccaagctga accggttgga aagcggcgtc       240
     tggaagcggg tgcgcgccga ggacatcacc gtgctgctcg acatctacgg gatcaccgcc       300
     ccggacgaac gcgccaccta tctcacgctt gtccgggagg ccatgcagaa gggctggtgg       360
     gcctcctaca gcgacgtgct tggcacgggc gaattcgtcg gtttggaagc ggaggcatcg       420
     cggatccgca ccttcgaatc agcggccatc ccaggactgc tgcagaccga ggactatgcc       480
     cgtgcgctca tgcgcgatag cgaacaaatc ggttcctcag ccagcctcga ccggagagtc       540
     caggcgcgca tgctgcgaca gcagatcctt aaccagagca gcccgcccga tttccacacc       600
     gtcatcgacg aatctgtcct gcttcggatt acccccgagc ttgccgggca gctcgaccac       660
     ctgtgggagg ccagtcaccg cccgcacacc gacatccgta tcctcccgct tagcagagga       720
     ccgcacgctg cgatgaccgg gcagttcgtc atcctggact ttcccctgcc caatcagccg       780
     gtggtctacc tcgaagctct ggcagaagag atcttacctg gacaaacctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page