(data stored in ACNUC7421 zone)

EMBL: CP000088.PE88

CP000088.PE88        Location/Qualifiers
FT   CDS_pept        112611..113462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0090"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54128"
FT                   /db_xref="GOA:Q47TT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54128.1"
FT                   /translation="MREPSGDYSPTIRRRRLSEELRRLRLARGLTLEQVAEKLEWSRAK
FT                   IANIETGKRLRPYVTDVELLLNVYGVDDPDQRAALLDLTRQSRTKGWWASYGGLLGDYV
FT                   GMEAEASSIATYQLGAIPGLLQTFDYAVALAQAMRYPPEDVERIAASRVRRQQLFARKN
FT                   PPRFHAVIDEAALIRPAAPDRPDVMRAQIHHLINRANDANVTLQLLPFTAGLHAGVSGP
FT                   FVLLEFPDPADRPVVYLETRAGGHYLEDTAEITEYQDLFTHLHTTALSHEATVARLAQL
FT                   AE"
     atgcgagaac ccagtggtga ctacagcccc acgatccggc ggcgtcgcct atcagaagag        60
     ttgagacggc tgcgccttgc ccgagggctc accctggagc aggtggcgga gaaactggag       120
     tggagcagag ccaaaatcgc caacatcgag accggcaaac ggctccgtcc ctatgtcacc       180
     gacgtcgaac tgctactcaa cgtctacggg gtcgacgatc ctgaccagcg cgcagcgctc       240
     ctcgacctca cccggcaatc ccgcactaaa ggctggtggg cctcctacgg tggcctgctc       300
     ggcgactatg tcggaatgga ggctgaagcc tcctccattg ccacctacca actgggcgcg       360
     atccctggtc tcctccagac tttcgactac gccgttgctc tcgcgcaagc aatgcgctac       420
     ccgccagagg acgtagagcg gattgccgct tcccgagtac ggcgtcaaca actctttgca       480
     aggaagaatc cgccgcgctt ccacgcggtc atcgacgagg ctgccctcat ccgtcccgcg       540
     gctcccgatc gtcccgacgt catgcgcgcg cagattcacc acctcatcaa ccgcgcaaac       600
     gacgccaacg tcaccctgca actgctgcct ttcaccgctg gcttgcacgc gggggtcagt       660
     ggaccgtttg tcctcctaga attccctgat ccggcagacc ggcccgtcgt ctacctggaa       720
     acccgggctg gcggccacta cttggaggac accgctgaga ttacggaata ccaggacctt       780
     ttcactcacc tgcacaccac agcgttgtct catgaagcaa ctgtcgcccg cctcgcccaa       840
     ctcgccgaat ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page