(data stored in ACNUC7421 zone)
EMBL: CP000088.PE89
CP000088.PE89 Location/Qualifiers
FT CDS_pept 113470..113661
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Tfu_0091"
FT /product="hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:Tfu_0091"
FT /db_xref="EnsemblGenomes-Tr:AAZ54129"
FT /db_xref="InterPro:IPR007278"
FT /db_xref="UniProtKB/TrEMBL:Q47TT5"
FT /inference="non-experimental evidence, no additional
FT details recorded"
FT /protein_id="AAZ54129.1"
FT /translation="MHTPDPAPLAFRKSSYSVTAQECVEVAVTSEFVAVRDSAHRELGY
FT LTFPLAEWRAFLTELTDR"
gtgcacacgc ccgatcccgc acctcttgcc ttccgcaagt ccagctacag cgtcaccgcg 60
caagagtgcg tggaagtcgc tgttacttcc gagtttgttg cggtgcggga ttctgcgcac 120
cgcgagttgg ggtatctcac cttcccactg gccgagtggc gtgctttcct caccgagctc 180
accgaccggt ga 192
//
If you have problems or comments...
Back to PBIL home page