(data stored in ACNUC7421 zone)

EMBL: CP000088.PE89

CP000088.PE89        Location/Qualifiers
FT   CDS_pept        113470..113661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54129"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54129.1"
FT                   /translation="MHTPDPAPLAFRKSSYSVTAQECVEVAVTSEFVAVRDSAHRELGY
FT                   LTFPLAEWRAFLTELTDR"
     gtgcacacgc ccgatcccgc acctcttgcc ttccgcaagt ccagctacag cgtcaccgcg        60
     caagagtgcg tggaagtcgc tgttacttcc gagtttgttg cggtgcggga ttctgcgcac       120
     cgcgagttgg ggtatctcac cttcccactg gccgagtggc gtgctttcct caccgagctc       180
     accgaccggt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page