(data stored in ACNUC7421 zone)

EMBL: CP000088.PE95

CP000088.PE95        Location/Qualifiers
FT   CDS_pept        complement(118103..119002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54135"
FT                   /db_xref="GOA:Q47TS9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54135.1"
FT                   /translation="MVTAGDGDGWVILADGSRRWGLYGASGLLLYSVDESGTGHVLLQH
FT                   RAPWTHQGGTWGLPGGARNSGESSVSAAIREFVEEVDGDLGTLSLLGIHRQDHQVWVFD
FT                   TVLASVPERRPFTPGNPESESIRWIPVPDVPSMPLLPAFGKVWPEVAAALSEQLLLIVD
FT                   TTVVPQSITPGALCHRLTELAQVGVTDDMLPPDVPLTPLHRRFPSVLLLVDAHSRAALP
FT                   APVHGVDVVQVSDGSAAAIAQLVSERLPQTRIVVATDHPDTRAQAAALGVHTAPVSWAY
FT                   ELAQREESSPVERGSSVT"
     atggtgaccg caggggatgg cgacggctgg gtgatcctgg ccgacggttc acggcggtgg        60
     ggactgtacg gggcttccgg actgctgttg tacagcgtgg acgagtccgg aaccggccac       120
     gtgctgctgc agcaccgtgc cccatggact caccagggcg gcacctgggg gctgcccggc       180
     ggtgcccgca acagcggcga gtcctctgtt tccgctgcga tccgcgaatt cgtcgaagag       240
     gtggacggcg acctgggcac gctgtctctg ctcggcatcc accggcaaga ccaccaggtc       300
     tgggtgttcg acaccgtgct ggccagtgtg ccggaacggc ggccgttcac tcccggcaac       360
     ccggagagcg agagcatccg ctggattccg gtccccgacg tgccgtcgat gccgctgctg       420
     cccgcgttcg ggaaggtctg gccggaggtg gcggccgcgc tctctgaaca gctcctgctg       480
     atcgtggaca ccacggtggt gccgcagtcc atcacccccg gcgcactgtg ccaccggttg       540
     actgagctgg cgcaggtcgg agttacggac gacatgcttc cccccgatgt gcccctcacc       600
     ccgctgcacc ggcgttttcc cagcgtgctg ctcctcgtgg acgcccacag ccgagccgcc       660
     ctgcctgccc ccgtccacgg ggtcgacgta gtccaggtgt cggacggcag tgccgccgca       720
     atagcgcagc tcgtctccga gcgcctgccg cagacccgca tcgtcgtcgc caccgaccat       780
     ccggacacgc gggcacaggc cgcggcccta ggcgtccaca cggcccccgt gtcgtgggcg       840
     tacgagcttg cccagcggga agagtccagc ccggtcgaac gcggctcctc agtaacgtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page