(data stored in ACNUC7421 zone)

EMBL: CP000088.PE99

CP000088.PE99        Location/Qualifiers
FT   CDS_pept        complement(123472..124254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54139"
FT                   /db_xref="GOA:Q47TS5"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54139.1"
FT                   /translation="MTLSSATAPPRSPRRLPGVRWNRTSLVVAITAFACVLVAAIFVPP
FT                   YLSLDPGSSRVALRPDSALHFPAVAIHAATGGIALLTGPLQFSRRLRRRGVWHRWIGRV
FT                   YLFAGVLPSALSGIVAALLTSSGPVAMAAFLSLDILWIITGLAAYRTARAGRYAAHREW
FT                   MLRNFSLTFAAVTLRIWLSALVAIQLPWLDSLYGGDFDQLFATAYAVSHWTSWLPNLLL
FT                   VEVYLARQAARQAREALATALQTTAAAADNTETSPTPA"
     atgactctct cttccgctac ggcaccgccc cgcagcccgc gccggcttcc gggtgtccgc        60
     tggaaccgca cctccctggt cgtggcaatc accgccttcg cctgcgtcct cgttgctgcg       120
     atctttgtgc ccccctacct gtccctcgac cccggctcca gcagggtcgc actccgcccg       180
     gattcggccc tgcactttcc cgccgtcgcc atccacgccg ccaccggtgg gatcgcgctg       240
     ctcaccggcc cactccagtt cagccggcga ctgcgccgcc gcggagtctg gcaccgctgg       300
     atcggccggg tctacctgtt cgccggagtg ctgccctcgg cgctcagcgg tatcgtcgcc       360
     gccctgctga cctccagcgg ccctgtggcg atggccgcgt tcctctccct cgacatcctg       420
     tggatcatca cgggcctcgc cgcctaccgg accgcccgcg ccggccgcta tgccgcacac       480
     cgggagtgga tgctgcgcaa cttctccctg acgttcgccg cagtcaccct gcgcatctgg       540
     ctcagtgcac tggtcgccat ccaacttccc tggctcgact ccctctacgg aggcgacttc       600
     gaccagctct tcgccaccgc ctacgccgtc agccactgga cgtcgtggct acccaacctg       660
     ctgctcgtcg aggtctacct ggcccggcag gctgcccgac aagcccggga agccctcgcc       720
     acggcgctcc agacgaccgc cgcggcagcc gacaacacgg aaacgtcccc gacccccgca       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page