(data stored in ACNUC7421 zone)

EMBL: CP000094.CYSC

CP000094.CYSC        Location/Qualifiers
FT   CDS_pept        560254..560865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="Pfl01_0483"
FT                   /product="adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72227"
FT                   /db_xref="GOA:Q3KJ29"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ29"
FT                   /protein_id="ABA72227.1"
FT                   /translation="MNEALHSLATTPAISPYNLALPRQARAALNGQRPRCLWLTGLSGA
FT                   GKSTLANSLELHLHQFGRHTFLLDGDNVRNGLCRDLGMDDAGRRENIRRMAEVARLMVD
FT                   AGLIVIVAAISPFRAERDAARRLFAEGDFVEVHVSTSLTVCERRDPKGLYQAVRQGRIQ
FT                   HFTGIDSPYEAPLAAECRIDTEEIEPSEACERLAALLLEK"
     atgaatgagg cgctgcacag tctggcgaca acgcccgcca tcagccccta taacctggcg        60
     ctgccgcgcc aggcccgggc cgcgctcaac gggcagcggc cgcgttgcct gtggctgacc       120
     ggattatccg gcgccggcaa gtcgaccctg gccaattcgc tggagctgca cctgcatcaa       180
     ttcgggcggc acacctttct gctcgatggc gacaacgtgc gcaatggcct gtgccgggac       240
     ctgggtatgg acgatgccgg tcgccgggaa aacatccggc gcatggccga agtcgcccgg       300
     ctgatggtcg atgccgggct gatcgtcatc gttgcggcga tttccccgtt tcgagccgaa       360
     cgggatgctg cgcggcgact gtttgccgag ggcgacttcg tcgaagtgca tgtgagcact       420
     tcgctcacgg tgtgcgagcg ccgtgatccg aaaggtttgt atcaggcggt gcgtcagggt       480
     cgtatccagc atttcacggg catcgacagt ccttacgagg ctccgctggc ggcggaatgc       540
     cgtatcgaca cggaagagat cgagccaagc gaggcctgcg aacggctggc ggctttgctg       600
     cttgaaaaat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page