(data stored in ACNUC7421 zone)

EMBL: CP000094.LAPB

CP000094.LAPB        Location/Qualifiers
FT   CDS_pept        162378..164543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="Pfl01_0135"
FT                   /product="ATP binding cassette protein component of ABC
FT                   transporter required for LapA secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71879"
FT                   /db_xref="GOA:Q3KK27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK27"
FT                   /protein_id="ABA71879.1"
FT                   /translation="MSSVESEVSRVHLSHDPRALHDDPLLDGLLALCMLHQKPASAAML
FT                   TTGLPLPKQRLSVELLPRAAARAGLQGRVLQRKLEEIPAIAMPALLLLKDGRSAVLLGW
FT                   QGENEARVLLSESDGGESLVSRELLADDYTGKVFFAQPQHKFDVNHGTLIPRARSWFRD
FT                   TLKRSRWLYADAIAASFLINIIAMAAPLFVMNVYDRVVPNQAEATLWVLALGITGAYLF
FT                   DLILKSLRSLCLDLAGKKTDLIISATLFERIVGMAMKYRPARVGSFAQNIHEFQSLRDF
FT                   LASLTLTSLIDLPFTLLIFIVIAILGGHLVWIPVLAFPIALLIGYALQKPLVATMERTM
FT                   ALGAERQSSLIETLAGLDAVKVNNAESERQYQWEQTIGTLSRLELRVKMLSGLAMNITL
FT                   LIQQLAGVIMIVFGVYQIIAGNLSMGGLIACYMLSGRALSPLASLSGLLTRYQQARVTM
FT                   TSVDQMMELPQERNFEERPLSRKVLQGAIECRQLSFTYPEQQNPALKNINLVIRPGEKI
FT                   GIIGRSGSGKSSLAKLLVGLYQPDDGALLVDGVDIRQIDVSELRYNIGYVPQDIQLLAG
FT                   TLRDNLISGARYVEDELVLQAAELAGVHEFARLHPQGYELQVGERGQNLSGGQRQNVAL
FT                   ARALLLNPPILLLDEPTSAMDNTGEERLKQRLAAVVENKTVVLVTHRASLLSLVDRLLV
FT                   VDRGQILADGPKAAVMEALKKGQISVA"
     gtgtcgagcg tggaatcaga agtcagtcga gttcatctca gtcatgatcc acgcgcgttg        60
     cacgacgatc cgttactgga tggtctgctc gctctctgca tgctgcatca gaaacccgcc       120
     agcgcggcca tgctgaccac cggcctgccg ctgccaaaac aacgcctgag tgtcgagctg       180
     ctgccccgtg cagcggcgcg cgccgggctg caagggcgag tcctgcaacg caagcttgaa       240
     gaaattccgg cgattgccat gccggcgctg ttgctgctca aggatggccg cagtgccgtc       300
     ctgctcggct ggcagggtga gaacgaagcg cgggtgctgc tcagcgaaag cgacggcggc       360
     gagtctctgg tcagccgcga actgctggcc gacgactaca ccggcaaagt gttcttcgcc       420
     cagccccagc acaaattcga cgtcaaccac ggcacgctga tcccgcgtgc acgctcgtgg       480
     tttcgggaca ccctcaagcg ttcgcgctgg ctgtacgccg acgccatcgc tgccagtttc       540
     ctgatcaaca tcatcgccat ggccgcgccg ctgttcgtga tgaacgtcta cgaccgcgtg       600
     gtgccgaacc aggccgaagc gaccctgtgg gtgctcgcac tgggcatcac cggcgcctac       660
     ctgttcgacc tgatcctcaa gagcctgcgc agcctgtgcc tggatctggc cggcaagaaa       720
     accgacctga tcatctccgc cacgctattc gaacgcatcg tcggcatggc catgaaatac       780
     cgcccggcgc gggtcggcag ctttgcccag aacatccacg agttccagag tctgcgtgac       840
     tttcttgcct cgctgaccct gaccagcctg attgacctgc cgttcaccct cctgatcttc       900
     attgtcatcg cgatactcgg cgggcatctg gtgtggattc cggtgctggc cttcccgatt       960
     gcgctgctga tcggctacgc gttgcagaag ccgctggtgg caaccatgga acgcaccatg      1020
     gccctcggcg ccgagcgtca gtcgagcctg atcgaaaccc tcgccggcct cgacgcggtg      1080
     aaggtcaaca acgctgaaag cgagcgccag taccagtggg aacagaccat cggcaccctc      1140
     agccgcctcg agctgcgggt gaaaatgctc tccggtctgg cgatgaacat caccctgctg      1200
     atccagcaac tggccggcgt gatcatgatc gtcttcggcg tgtaccagat catcgccggc      1260
     aacctgagca tgggcggcct gatcgcctgc tacatgctca gtggccgcgc cctcagcccg      1320
     ctggcgtcgc tgtccggtct gctgacccgc taccagcagg cgcgggtgac catgacctcg      1380
     gtcgaccaga tgatggagtt gccgcaagag cgcaatttcg aagagcgccc gctgagccgc      1440
     aaggtgctgc aaggcgcgat cgaatgccgc cagctcagct tcacctaccc ggagcaacag      1500
     aatccggcgc tgaagaacat caacctggtg atccgtcccg gcgagaagat cggcatcatc      1560
     ggccgcagcg gctcgggcaa aagttcgctg gcgaaattgc tggtcggcct ctatcagccg      1620
     gacgacggtg cgttgctggt ggacggcgtc gacatccgcc agatcgacgt cagcgagttg      1680
     cgctacaaca tcggctacgt gccgcaggac atccagctgc tggccggcac cttgcgcgac      1740
     aacttgattt ccggcgcccg ttacgtcgaa gacgaacttg tcttgcaggc cgctgaactg      1800
     gccggcgtcc acgaattcgc ccgactgcac ccgcagggtt atgaactgca agtcggcgag      1860
     cgtggacaga acctgtccgg cggtcagcgc cagaacgttg ccctggctcg ggcgctgttg      1920
     ctcaatccgc cgatcctgtt gctcgacgaa ccgaccagcg ccatggacaa caccggcgaa      1980
     gaacgcctca agcaacgcct cgcggcggtg gtggaaaaca agaccgtggt gctggtgacg      2040
     caccgggcat cgctgctgtc gctggtcgac cgcctgctgg tggtcgaccg tggacagatc      2100
     ctcgccgacg gcccgaaagc ggccgtcatg gaagcgttga agaaggggca gatcagtgtt      2160
     gcttaa                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page